Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2K1D2

Protein Details
Accession S2K1D2    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
307-327NNSILRKLRRIEKKLSPNSSTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito_nucl 10.666, cyto_nucl 9.833, mito 8.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002885  Pentatricopeptide_repeat  
IPR011990  TPR-like_helical_dom_sf  
Pfam View protein in Pfam  
PF13812  PPR_3  
PROSITE View protein in PROSITE  
PS51375  PPR  
Amino Acid Sequences MVPELKPDLAKSAVRALFSLSAQTGQVELFERAFQLNKKFDLSLTHVGLSSLVACYLMKGDVQSAKSTFKIVASHTSGPDVVDFNLLMRATVMEEDKASAYDKILDILTHMKLVNVTPDLSTMRTMLNSYDSTSTMRNSLYNKLLNSPSASRADQVFLNNIAITNLLAKKDIEFMVGLLFRDNRGELFPGQDNKPIEVNGLTFKILMDAATFDVKNSSIAEKLFKSMRSRGMKPEKETYEKLISILARKGRLQKARRYITKMEQETGCKADVETYTKLVDGLLRIGKPHLAKEIIMQDMPLNDIPLNNSILRKLRRIEKKLSPNSSTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.29
4 0.27
5 0.26
6 0.27
7 0.18
8 0.17
9 0.16
10 0.16
11 0.14
12 0.1
13 0.12
14 0.12
15 0.12
16 0.12
17 0.12
18 0.13
19 0.14
20 0.18
21 0.21
22 0.26
23 0.29
24 0.3
25 0.33
26 0.32
27 0.32
28 0.34
29 0.36
30 0.36
31 0.34
32 0.32
33 0.3
34 0.29
35 0.28
36 0.23
37 0.16
38 0.09
39 0.07
40 0.06
41 0.06
42 0.06
43 0.07
44 0.07
45 0.07
46 0.07
47 0.1
48 0.15
49 0.16
50 0.19
51 0.2
52 0.22
53 0.22
54 0.23
55 0.21
56 0.18
57 0.19
58 0.18
59 0.23
60 0.26
61 0.28
62 0.28
63 0.28
64 0.26
65 0.24
66 0.23
67 0.17
68 0.12
69 0.11
70 0.1
71 0.09
72 0.11
73 0.11
74 0.1
75 0.08
76 0.08
77 0.08
78 0.09
79 0.1
80 0.07
81 0.08
82 0.09
83 0.09
84 0.09
85 0.1
86 0.09
87 0.09
88 0.1
89 0.1
90 0.1
91 0.1
92 0.09
93 0.1
94 0.12
95 0.12
96 0.12
97 0.12
98 0.11
99 0.11
100 0.12
101 0.13
102 0.11
103 0.11
104 0.09
105 0.11
106 0.12
107 0.12
108 0.12
109 0.1
110 0.1
111 0.1
112 0.1
113 0.09
114 0.11
115 0.11
116 0.12
117 0.12
118 0.12
119 0.13
120 0.14
121 0.14
122 0.12
123 0.12
124 0.13
125 0.14
126 0.18
127 0.21
128 0.23
129 0.22
130 0.25
131 0.25
132 0.23
133 0.24
134 0.21
135 0.2
136 0.2
137 0.2
138 0.17
139 0.17
140 0.17
141 0.16
142 0.15
143 0.13
144 0.11
145 0.11
146 0.1
147 0.09
148 0.08
149 0.07
150 0.06
151 0.07
152 0.07
153 0.07
154 0.08
155 0.08
156 0.08
157 0.1
158 0.11
159 0.09
160 0.08
161 0.08
162 0.09
163 0.09
164 0.09
165 0.08
166 0.08
167 0.07
168 0.08
169 0.08
170 0.07
171 0.07
172 0.09
173 0.08
174 0.11
175 0.14
176 0.17
177 0.18
178 0.23
179 0.22
180 0.22
181 0.22
182 0.19
183 0.17
184 0.14
185 0.14
186 0.11
187 0.11
188 0.1
189 0.09
190 0.09
191 0.09
192 0.08
193 0.07
194 0.05
195 0.05
196 0.06
197 0.08
198 0.08
199 0.08
200 0.09
201 0.09
202 0.09
203 0.1
204 0.1
205 0.09
206 0.1
207 0.14
208 0.13
209 0.16
210 0.18
211 0.21
212 0.24
213 0.27
214 0.36
215 0.4
216 0.42
217 0.49
218 0.57
219 0.6
220 0.61
221 0.65
222 0.62
223 0.61
224 0.6
225 0.56
226 0.51
227 0.45
228 0.4
229 0.34
230 0.3
231 0.27
232 0.3
233 0.28
234 0.25
235 0.28
236 0.36
237 0.41
238 0.49
239 0.52
240 0.57
241 0.64
242 0.71
243 0.74
244 0.73
245 0.72
246 0.71
247 0.74
248 0.68
249 0.63
250 0.57
251 0.53
252 0.49
253 0.45
254 0.37
255 0.27
256 0.23
257 0.23
258 0.22
259 0.23
260 0.22
261 0.22
262 0.21
263 0.21
264 0.21
265 0.17
266 0.16
267 0.12
268 0.15
269 0.17
270 0.17
271 0.18
272 0.19
273 0.23
274 0.23
275 0.25
276 0.26
277 0.23
278 0.23
279 0.28
280 0.32
281 0.31
282 0.29
283 0.27
284 0.23
285 0.22
286 0.24
287 0.19
288 0.15
289 0.12
290 0.13
291 0.15
292 0.16
293 0.19
294 0.18
295 0.19
296 0.22
297 0.3
298 0.34
299 0.37
300 0.41
301 0.48
302 0.57
303 0.63
304 0.67
305 0.69
306 0.76
307 0.81
308 0.82