Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2J1J1

Protein Details
Accession S2J1J1    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-41IPKTRNTYCKGSKCRKHTPHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MDNDRNLAFDDDVNIPKTRNTYCKGSKCRKHTPHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLECTACKYKMQLAIKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.21
4 0.25
5 0.26
6 0.29
7 0.31
8 0.38
9 0.46
10 0.56
11 0.64
12 0.71
13 0.75
14 0.77
15 0.83
16 0.84
17 0.86
18 0.87
19 0.86
20 0.86
21 0.88
22 0.88
23 0.8
24 0.79
25 0.76
26 0.69
27 0.62
28 0.54
29 0.43
30 0.36
31 0.35
32 0.34
33 0.29
34 0.27
35 0.32
36 0.36
37 0.4
38 0.44
39 0.49
40 0.45
41 0.52
42 0.59
43 0.56
44 0.58
45 0.56
46 0.55
47 0.54
48 0.57
49 0.48
50 0.43
51 0.4
52 0.33
53 0.35
54 0.37
55 0.37
56 0.32
57 0.39
58 0.43
59 0.51
60 0.6
61 0.63
62 0.62
63 0.66
64 0.73
65 0.73
66 0.72
67 0.69
68 0.64
69 0.61
70 0.59
71 0.54
72 0.49
73 0.46
74 0.4
75 0.35
76 0.32
77 0.32
78 0.35
79 0.41
80 0.43
81 0.47
82 0.56
83 0.63
84 0.68
85 0.66
86 0.6
87 0.56
88 0.51
89 0.49
90 0.5
91 0.5
92 0.52
93 0.54
94 0.52
95 0.49
96 0.49
97 0.42