Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2JUR9

Protein Details
Accession S2JUR9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
84-108GRDSHQLNSRKKKKAHNDANVIQYNHydrophilic
NLS Segment(s)
PositionSequence
116-129RKGKEKESRKRKLA
Subcellular Location(s) nucl 14, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Pfam View protein in Pfam  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MYFQVVINSFSGFGPFCLKFKPDEPCTVYDLKQKLASTTTFSVEEQKIRSLGGRILTDNDSLFQDYSIHEGPIILNLTVRLIGGRDSHQLNSRKKKKAHNDANVIQYNDTMALASRKGKEKESRKRKLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.16
4 0.18
5 0.19
6 0.21
7 0.26
8 0.34
9 0.32
10 0.39
11 0.41
12 0.41
13 0.44
14 0.44
15 0.41
16 0.4
17 0.38
18 0.32
19 0.33
20 0.3
21 0.28
22 0.27
23 0.26
24 0.23
25 0.23
26 0.23
27 0.2
28 0.2
29 0.24
30 0.23
31 0.24
32 0.2
33 0.2
34 0.18
35 0.17
36 0.18
37 0.14
38 0.14
39 0.15
40 0.15
41 0.14
42 0.16
43 0.17
44 0.16
45 0.15
46 0.14
47 0.11
48 0.1
49 0.1
50 0.07
51 0.07
52 0.06
53 0.1
54 0.1
55 0.09
56 0.08
57 0.08
58 0.08
59 0.1
60 0.1
61 0.07
62 0.06
63 0.06
64 0.07
65 0.07
66 0.07
67 0.05
68 0.04
69 0.05
70 0.07
71 0.09
72 0.12
73 0.13
74 0.15
75 0.23
76 0.31
77 0.39
78 0.49
79 0.56
80 0.62
81 0.67
82 0.75
83 0.79
84 0.82
85 0.83
86 0.82
87 0.82
88 0.79
89 0.81
90 0.75
91 0.66
92 0.54
93 0.44
94 0.34
95 0.25
96 0.2
97 0.11
98 0.08
99 0.09
100 0.11
101 0.16
102 0.2
103 0.28
104 0.31
105 0.38
106 0.47
107 0.56
108 0.65
109 0.72