Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2IY49

Protein Details
Accession S2IY49    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
109-129LPPVNQQPRYNNNHNQRRRRHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR035912  EHR_sf  
IPR000781  ERH  
Pfam View protein in Pfam  
PF01133  ER  
Amino Acid Sequences MIHSICRIRIRTNDKHITTAPELTCDDFPTESEAMDHIANLYEVRLAKENPNAGQVQYRAEDLFRFIDTYKEFVALVFDPSALTYQPRDKDWIKDRLIAHFSGQQAEELPPVNQQPRYNNNHNQRRRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.65
3 0.62
4 0.59
5 0.53
6 0.5
7 0.4
8 0.34
9 0.33
10 0.3
11 0.29
12 0.24
13 0.22
14 0.16
15 0.16
16 0.17
17 0.16
18 0.13
19 0.13
20 0.12
21 0.12
22 0.11
23 0.11
24 0.06
25 0.07
26 0.07
27 0.06
28 0.06
29 0.07
30 0.07
31 0.09
32 0.11
33 0.12
34 0.14
35 0.18
36 0.2
37 0.19
38 0.21
39 0.2
40 0.18
41 0.2
42 0.18
43 0.16
44 0.14
45 0.14
46 0.12
47 0.12
48 0.11
49 0.1
50 0.1
51 0.08
52 0.09
53 0.08
54 0.11
55 0.11
56 0.13
57 0.11
58 0.11
59 0.11
60 0.1
61 0.12
62 0.09
63 0.1
64 0.08
65 0.08
66 0.07
67 0.07
68 0.08
69 0.06
70 0.07
71 0.08
72 0.14
73 0.16
74 0.17
75 0.22
76 0.24
77 0.32
78 0.39
79 0.45
80 0.43
81 0.47
82 0.46
83 0.48
84 0.49
85 0.41
86 0.36
87 0.31
88 0.3
89 0.26
90 0.25
91 0.18
92 0.17
93 0.17
94 0.17
95 0.14
96 0.13
97 0.14
98 0.18
99 0.22
100 0.25
101 0.28
102 0.35
103 0.43
104 0.51
105 0.57
106 0.63
107 0.69
108 0.76
109 0.82