Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S2K233

Protein Details
Accession S2K233    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
144-170GFESYRKQYHARKKARQAKLKKSSSAQHydrophilic
NLS Segment(s)
PositionSequence
154-165ARKKARQAKLKK
Subcellular Location(s) plas 11, nucl 7, mito 6, E.R. 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR019168  NEP1-R1  
IPR005605  Spo7  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0071595  C:Nem1-Spo7 phosphatase complex  
GO:0031965  C:nuclear membrane  
GO:0019888  F:protein phosphatase regulator activity  
GO:0006629  P:lipid metabolic process  
GO:0035307  P:positive regulation of protein dephosphorylation  
Pfam View protein in Pfam  
PF03907  Spo7  
Amino Acid Sequences MNTEKNNKDARPRTPNSNTATYRDLVIFEERLRGNMTRLLKRKRKYETLLVGLFVSLTYFFYAVFIDPSKVFMFHLLNTITLLSVAGGLVFFYRSGMYSEKIVFAQKFVPHCNIALSSFNLQFNKEQGGGLSFLTKIPKQFQDGFESYRKQYHARKKARQAKLKKSSSAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.69
4 0.71
5 0.64
6 0.58
7 0.56
8 0.46
9 0.41
10 0.34
11 0.28
12 0.21
13 0.21
14 0.19
15 0.16
16 0.22
17 0.2
18 0.21
19 0.23
20 0.21
21 0.2
22 0.24
23 0.3
24 0.33
25 0.42
26 0.51
27 0.56
28 0.62
29 0.68
30 0.7
31 0.73
32 0.7
33 0.71
34 0.69
35 0.67
36 0.61
37 0.53
38 0.45
39 0.36
40 0.3
41 0.2
42 0.12
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.05
51 0.07
52 0.07
53 0.08
54 0.08
55 0.1
56 0.1
57 0.1
58 0.1
59 0.11
60 0.12
61 0.1
62 0.14
63 0.12
64 0.11
65 0.11
66 0.11
67 0.08
68 0.07
69 0.07
70 0.04
71 0.03
72 0.03
73 0.02
74 0.02
75 0.02
76 0.02
77 0.03
78 0.03
79 0.03
80 0.03
81 0.04
82 0.06
83 0.08
84 0.09
85 0.1
86 0.11
87 0.12
88 0.12
89 0.14
90 0.12
91 0.12
92 0.15
93 0.16
94 0.18
95 0.2
96 0.22
97 0.21
98 0.21
99 0.21
100 0.18
101 0.17
102 0.17
103 0.16
104 0.17
105 0.18
106 0.21
107 0.2
108 0.2
109 0.2
110 0.19
111 0.2
112 0.17
113 0.15
114 0.13
115 0.14
116 0.13
117 0.13
118 0.12
119 0.09
120 0.1
121 0.14
122 0.15
123 0.16
124 0.21
125 0.24
126 0.28
127 0.33
128 0.35
129 0.39
130 0.41
131 0.43
132 0.44
133 0.45
134 0.41
135 0.41
136 0.41
137 0.4
138 0.46
139 0.53
140 0.57
141 0.64
142 0.72
143 0.78
144 0.87
145 0.9
146 0.91
147 0.9
148 0.91
149 0.91
150 0.88