Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RD43

Protein Details
Accession F4RD43   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
152-178VTAFRKSWSRAERRKRKPCTQPTGERLHydrophilic
NLS Segment(s)
PositionSequence
161-168RAERRKRK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010286  METTL16/RlmF  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0006725  P:cellular aromatic compound metabolic process  
GO:0034641  P:cellular nitrogen compound metabolic process  
GO:0046483  P:heterocycle metabolic process  
GO:1901360  P:organic cyclic compound metabolic process  
GO:0044238  P:primary metabolic process  
KEGG mlr:MELLADRAFT_95348  -  
Pfam View protein in Pfam  
PF05971  Methyltransf_10  
Amino Acid Sequences MITSGGEVSFINQLIRDSLALKDHVRWFTSLCGKFSTLTEVVKTFKTLQGNNYALGELLQGQTRRWVIGWSWQDWRVRDALCKPSTVESFRSTKNLLPLPNEIDYHLPSLVMSVSLKDLTTRITQILASLPDLSWQMCPLQNGDGEHVSWEVTAFRKSWSRAERRKRKPCTQPTGERLPAKNASSEGSTDRVRAEPCLTESSSNGHPTPIMKVSLTLSCTPSIEEHEKQPKDCSSKEATSSQTDKATFQLAPSSDVVYKLDIRWLRGYERDIFESFWNHLIKKVIQCDEKFFTADKAQDMTGMMTIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.13
4 0.12
5 0.13
6 0.16
7 0.19
8 0.2
9 0.25
10 0.31
11 0.34
12 0.34
13 0.33
14 0.31
15 0.35
16 0.44
17 0.41
18 0.36
19 0.36
20 0.35
21 0.35
22 0.34
23 0.34
24 0.26
25 0.24
26 0.25
27 0.23
28 0.24
29 0.24
30 0.26
31 0.22
32 0.24
33 0.28
34 0.29
35 0.31
36 0.37
37 0.38
38 0.36
39 0.34
40 0.3
41 0.23
42 0.21
43 0.17
44 0.1
45 0.09
46 0.12
47 0.11
48 0.12
49 0.17
50 0.17
51 0.17
52 0.16
53 0.17
54 0.15
55 0.23
56 0.28
57 0.26
58 0.3
59 0.34
60 0.37
61 0.36
62 0.37
63 0.32
64 0.28
65 0.31
66 0.32
67 0.37
68 0.34
69 0.34
70 0.33
71 0.34
72 0.37
73 0.35
74 0.32
75 0.27
76 0.31
77 0.31
78 0.33
79 0.3
80 0.28
81 0.32
82 0.32
83 0.3
84 0.29
85 0.31
86 0.31
87 0.31
88 0.29
89 0.24
90 0.22
91 0.21
92 0.19
93 0.16
94 0.12
95 0.09
96 0.1
97 0.09
98 0.07
99 0.06
100 0.05
101 0.06
102 0.07
103 0.07
104 0.07
105 0.07
106 0.09
107 0.1
108 0.11
109 0.1
110 0.1
111 0.1
112 0.11
113 0.12
114 0.1
115 0.1
116 0.09
117 0.08
118 0.09
119 0.09
120 0.09
121 0.07
122 0.07
123 0.08
124 0.09
125 0.1
126 0.09
127 0.11
128 0.11
129 0.12
130 0.13
131 0.12
132 0.11
133 0.11
134 0.1
135 0.08
136 0.07
137 0.06
138 0.05
139 0.06
140 0.07
141 0.07
142 0.09
143 0.12
144 0.14
145 0.21
146 0.28
147 0.37
148 0.46
149 0.57
150 0.66
151 0.73
152 0.82
153 0.84
154 0.86
155 0.87
156 0.87
157 0.86
158 0.84
159 0.81
160 0.77
161 0.76
162 0.72
163 0.66
164 0.56
165 0.52
166 0.47
167 0.39
168 0.34
169 0.26
170 0.22
171 0.19
172 0.19
173 0.16
174 0.15
175 0.15
176 0.15
177 0.15
178 0.16
179 0.16
180 0.16
181 0.16
182 0.14
183 0.16
184 0.19
185 0.19
186 0.17
187 0.17
188 0.19
189 0.21
190 0.22
191 0.2
192 0.16
193 0.16
194 0.16
195 0.19
196 0.18
197 0.16
198 0.13
199 0.14
200 0.16
201 0.18
202 0.2
203 0.18
204 0.18
205 0.17
206 0.17
207 0.17
208 0.16
209 0.19
210 0.22
211 0.22
212 0.29
213 0.38
214 0.4
215 0.4
216 0.44
217 0.45
218 0.44
219 0.44
220 0.42
221 0.39
222 0.41
223 0.43
224 0.43
225 0.4
226 0.41
227 0.43
228 0.4
229 0.37
230 0.34
231 0.31
232 0.28
233 0.28
234 0.21
235 0.19
236 0.21
237 0.18
238 0.2
239 0.2
240 0.21
241 0.19
242 0.2
243 0.2
244 0.17
245 0.18
246 0.16
247 0.22
248 0.21
249 0.24
250 0.28
251 0.3
252 0.31
253 0.34
254 0.37
255 0.37
256 0.4
257 0.4
258 0.36
259 0.36
260 0.35
261 0.33
262 0.31
263 0.3
264 0.28
265 0.24
266 0.26
267 0.29
268 0.32
269 0.36
270 0.42
271 0.44
272 0.48
273 0.5
274 0.54
275 0.54
276 0.51
277 0.46
278 0.39
279 0.36
280 0.34
281 0.35
282 0.31
283 0.28
284 0.26
285 0.25
286 0.25
287 0.21