Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2J9W5

Protein Details
Accession S2J9W5   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
72-92SDRLTRRKKAMYRTYVKRPPAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 14.333, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028133  Dynamitin  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005869  C:dynactin complex  
GO:0007017  P:microtubule-based process  
Pfam View protein in Pfam  
PF04912  Dynamitin  
Amino Acid Sequences MSSKYSTLPDIDDQPDVYETPDSTDNVTNVSYENQSSDEDDNESVVKSRVSVKDAANRFKGSIVDSTDTDFSDRLTRRKKAMYRTYVKRPPAMETNEYEILPKNLSLDETPLQKLRRLMYEVQELNDEMEKAKEPADAKETISQSDILSQIAYLQSDLVRMNQQVGDDDLSQKSNYGKSIEDAKSLIKQLEAFKNIPAATPSDKKEESDTAVSEKNDKNDMVTYELFYTPETAKMQKESKLSDIDERIAKIEKLVGSNAGQALDELPQNLASTSLVNSLSKLEQLVVVLAQPRQLEMVARRVKVLNSDLDRLNELKSGRKDTSSLGFGLTSSINPQNTPSTNEATNKDGNDNEAKINKLFATLEKVDPLLNLTPALLTRLKALQTLHTEAASFGQSVKVISEEQTRMTDELKSLTTTCDLLNKSLKENDESINNNIKVIDDRMTDLIQRMTALSNADA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.23
4 0.21
5 0.17
6 0.14
7 0.17
8 0.19
9 0.18
10 0.2
11 0.24
12 0.22
13 0.22
14 0.22
15 0.19
16 0.17
17 0.19
18 0.18
19 0.15
20 0.16
21 0.16
22 0.17
23 0.19
24 0.2
25 0.19
26 0.19
27 0.18
28 0.18
29 0.17
30 0.17
31 0.15
32 0.14
33 0.13
34 0.12
35 0.19
36 0.22
37 0.25
38 0.3
39 0.33
40 0.42
41 0.49
42 0.55
43 0.52
44 0.5
45 0.47
46 0.44
47 0.4
48 0.33
49 0.31
50 0.28
51 0.26
52 0.25
53 0.27
54 0.26
55 0.24
56 0.23
57 0.18
58 0.15
59 0.21
60 0.24
61 0.3
62 0.37
63 0.42
64 0.47
65 0.56
66 0.62
67 0.64
68 0.71
69 0.73
70 0.74
71 0.78
72 0.83
73 0.82
74 0.79
75 0.74
76 0.65
77 0.6
78 0.58
79 0.56
80 0.49
81 0.44
82 0.46
83 0.43
84 0.41
85 0.37
86 0.3
87 0.25
88 0.22
89 0.18
90 0.13
91 0.12
92 0.13
93 0.12
94 0.15
95 0.17
96 0.19
97 0.22
98 0.25
99 0.26
100 0.28
101 0.31
102 0.29
103 0.31
104 0.32
105 0.34
106 0.34
107 0.42
108 0.4
109 0.37
110 0.36
111 0.31
112 0.27
113 0.25
114 0.2
115 0.11
116 0.11
117 0.11
118 0.11
119 0.11
120 0.13
121 0.13
122 0.16
123 0.19
124 0.19
125 0.2
126 0.26
127 0.26
128 0.23
129 0.23
130 0.21
131 0.17
132 0.19
133 0.17
134 0.11
135 0.1
136 0.09
137 0.09
138 0.09
139 0.09
140 0.06
141 0.06
142 0.06
143 0.08
144 0.08
145 0.09
146 0.1
147 0.1
148 0.12
149 0.12
150 0.12
151 0.11
152 0.13
153 0.13
154 0.11
155 0.13
156 0.13
157 0.13
158 0.13
159 0.13
160 0.13
161 0.13
162 0.14
163 0.14
164 0.13
165 0.14
166 0.23
167 0.23
168 0.22
169 0.21
170 0.21
171 0.22
172 0.23
173 0.21
174 0.13
175 0.15
176 0.18
177 0.23
178 0.25
179 0.23
180 0.22
181 0.25
182 0.25
183 0.23
184 0.18
185 0.16
186 0.16
187 0.2
188 0.21
189 0.24
190 0.24
191 0.24
192 0.26
193 0.25
194 0.24
195 0.22
196 0.2
197 0.18
198 0.2
199 0.2
200 0.22
201 0.22
202 0.21
203 0.21
204 0.2
205 0.19
206 0.17
207 0.18
208 0.16
209 0.15
210 0.14
211 0.14
212 0.14
213 0.13
214 0.11
215 0.13
216 0.09
217 0.11
218 0.12
219 0.12
220 0.13
221 0.17
222 0.19
223 0.21
224 0.24
225 0.23
226 0.24
227 0.26
228 0.26
229 0.26
230 0.25
231 0.23
232 0.22
233 0.21
234 0.19
235 0.17
236 0.16
237 0.12
238 0.13
239 0.12
240 0.12
241 0.12
242 0.12
243 0.11
244 0.13
245 0.13
246 0.1
247 0.09
248 0.08
249 0.08
250 0.08
251 0.07
252 0.06
253 0.06
254 0.06
255 0.06
256 0.06
257 0.06
258 0.05
259 0.06
260 0.06
261 0.08
262 0.09
263 0.08
264 0.09
265 0.1
266 0.1
267 0.1
268 0.1
269 0.08
270 0.07
271 0.07
272 0.07
273 0.06
274 0.06
275 0.08
276 0.08
277 0.1
278 0.09
279 0.09
280 0.09
281 0.1
282 0.11
283 0.12
284 0.21
285 0.24
286 0.25
287 0.26
288 0.27
289 0.27
290 0.28
291 0.29
292 0.26
293 0.24
294 0.27
295 0.27
296 0.27
297 0.28
298 0.26
299 0.24
300 0.2
301 0.18
302 0.22
303 0.24
304 0.29
305 0.28
306 0.29
307 0.29
308 0.29
309 0.33
310 0.28
311 0.24
312 0.19
313 0.18
314 0.16
315 0.17
316 0.14
317 0.09
318 0.11
319 0.14
320 0.14
321 0.14
322 0.16
323 0.2
324 0.21
325 0.25
326 0.25
327 0.25
328 0.28
329 0.32
330 0.32
331 0.31
332 0.33
333 0.3
334 0.29
335 0.26
336 0.27
337 0.27
338 0.26
339 0.26
340 0.26
341 0.26
342 0.24
343 0.25
344 0.22
345 0.19
346 0.19
347 0.16
348 0.21
349 0.21
350 0.22
351 0.22
352 0.22
353 0.2
354 0.19
355 0.21
356 0.15
357 0.13
358 0.12
359 0.11
360 0.11
361 0.11
362 0.15
363 0.13
364 0.11
365 0.13
366 0.17
367 0.17
368 0.19
369 0.2
370 0.23
371 0.27
372 0.32
373 0.3
374 0.27
375 0.27
376 0.24
377 0.25
378 0.2
379 0.14
380 0.1
381 0.1
382 0.11
383 0.11
384 0.11
385 0.11
386 0.1
387 0.13
388 0.19
389 0.19
390 0.21
391 0.23
392 0.25
393 0.24
394 0.25
395 0.24
396 0.19
397 0.2
398 0.19
399 0.19
400 0.18
401 0.19
402 0.19
403 0.18
404 0.18
405 0.22
406 0.22
407 0.25
408 0.32
409 0.32
410 0.35
411 0.39
412 0.41
413 0.38
414 0.39
415 0.37
416 0.37
417 0.39
418 0.4
419 0.45
420 0.42
421 0.39
422 0.36
423 0.34
424 0.3
425 0.29
426 0.27
427 0.19
428 0.22
429 0.24
430 0.25
431 0.25
432 0.25
433 0.24
434 0.2
435 0.19
436 0.18
437 0.16
438 0.17