Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2JHZ0

Protein Details
Accession S2JHZ0    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
29-53VSTSVIVKKRRHPKNSKTKKTYMTLHydrophilic
NLS Segment(s)
PositionSequence
36-48KKRRHPKNSKTKK
Subcellular Location(s) nucl 22, cyto 4.5, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MTDTWLTNTPFEEDNESSGTSNERIEEKVSTSVIVKKRRHPKNSKTKKTYMTLGKPKIHIANQGILNDLVKLGVKSNIEDGPLAAVNEVVASVNTAQSADDADHNSKSDIDDESGTKVENDKGFTMTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.23
4 0.21
5 0.19
6 0.2
7 0.15
8 0.15
9 0.14
10 0.14
11 0.14
12 0.16
13 0.16
14 0.17
15 0.18
16 0.18
17 0.17
18 0.17
19 0.23
20 0.28
21 0.36
22 0.38
23 0.44
24 0.54
25 0.63
26 0.72
27 0.75
28 0.79
29 0.81
30 0.88
31 0.9
32 0.88
33 0.85
34 0.81
35 0.75
36 0.72
37 0.69
38 0.67
39 0.65
40 0.65
41 0.61
42 0.56
43 0.54
44 0.5
45 0.42
46 0.37
47 0.3
48 0.27
49 0.26
50 0.25
51 0.23
52 0.2
53 0.18
54 0.14
55 0.12
56 0.07
57 0.05
58 0.05
59 0.05
60 0.08
61 0.08
62 0.08
63 0.11
64 0.12
65 0.12
66 0.12
67 0.11
68 0.1
69 0.1
70 0.1
71 0.07
72 0.06
73 0.05
74 0.05
75 0.05
76 0.03
77 0.03
78 0.04
79 0.04
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.08
88 0.12
89 0.14
90 0.15
91 0.16
92 0.17
93 0.16
94 0.16
95 0.16
96 0.15
97 0.15
98 0.16
99 0.16
100 0.18
101 0.18
102 0.18
103 0.17
104 0.17
105 0.2
106 0.21
107 0.23
108 0.22