Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2J8X0

Protein Details
Accession S2J8X0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
72-91PAPHKPLKYKPNKLEKHERMBasic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 13, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040922  MRPL25_dom  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MATYRNFSLKFLSKLNNAKLVEGDVKAQLVFNAEKGKSFWRPAQISKRTQNDLRKACLQCGIEPTSIGLAAPAPHKPLKYKPNKLEKHERMRAERQANIQRNLEKMPQTIQAWKEDKLKELAKQKTSMPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.54
4 0.48
5 0.45
6 0.4
7 0.38
8 0.34
9 0.27
10 0.24
11 0.17
12 0.17
13 0.16
14 0.15
15 0.11
16 0.12
17 0.11
18 0.12
19 0.17
20 0.16
21 0.17
22 0.19
23 0.24
24 0.25
25 0.28
26 0.29
27 0.32
28 0.35
29 0.42
30 0.51
31 0.54
32 0.57
33 0.61
34 0.64
35 0.6
36 0.63
37 0.64
38 0.63
39 0.59
40 0.56
41 0.56
42 0.51
43 0.47
44 0.45
45 0.38
46 0.3
47 0.3
48 0.28
49 0.2
50 0.19
51 0.18
52 0.13
53 0.12
54 0.1
55 0.06
56 0.04
57 0.05
58 0.06
59 0.06
60 0.09
61 0.11
62 0.12
63 0.15
64 0.22
65 0.32
66 0.41
67 0.51
68 0.57
69 0.66
70 0.73
71 0.77
72 0.81
73 0.8
74 0.8
75 0.78
76 0.74
77 0.71
78 0.71
79 0.72
80 0.66
81 0.6
82 0.59
83 0.61
84 0.63
85 0.6
86 0.57
87 0.51
88 0.49
89 0.48
90 0.44
91 0.37
92 0.31
93 0.3
94 0.31
95 0.31
96 0.34
97 0.33
98 0.37
99 0.37
100 0.4
101 0.45
102 0.4
103 0.42
104 0.43
105 0.45
106 0.43
107 0.5
108 0.55
109 0.52
110 0.53