Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2JSY3

Protein Details
Accession S2JSY3   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-22WSPRNNGRNKHGRGHNKVVRBasic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, mito 10, cyto_nucl 9, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MYWSPRNNGRNKHGRGHNKVVRCINCYRCVPKDKAIKRFTIRNMVEAAAVRDLQEASIYEEYAIPKLYVKLHYCISCAIHARVVRVRSAVDRRNRLPPPRFRFQKAANKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.79
3 0.81
4 0.78
5 0.74
6 0.76
7 0.75
8 0.68
9 0.63
10 0.62
11 0.57
12 0.56
13 0.55
14 0.54
15 0.52
16 0.55
17 0.55
18 0.55
19 0.6
20 0.6
21 0.65
22 0.62
23 0.63
24 0.6
25 0.63
26 0.59
27 0.59
28 0.52
29 0.44
30 0.42
31 0.35
32 0.31
33 0.24
34 0.21
35 0.12
36 0.11
37 0.09
38 0.08
39 0.08
40 0.06
41 0.06
42 0.06
43 0.08
44 0.08
45 0.08
46 0.07
47 0.09
48 0.09
49 0.1
50 0.1
51 0.07
52 0.07
53 0.09
54 0.11
55 0.15
56 0.17
57 0.19
58 0.22
59 0.23
60 0.23
61 0.24
62 0.23
63 0.22
64 0.23
65 0.21
66 0.22
67 0.22
68 0.25
69 0.27
70 0.27
71 0.25
72 0.23
73 0.24
74 0.26
75 0.34
76 0.38
77 0.43
78 0.5
79 0.52
80 0.61
81 0.66
82 0.69
83 0.7
84 0.73
85 0.72
86 0.75
87 0.78
88 0.75
89 0.77
90 0.77