Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RXB5

Protein Details
Accession F4RXB5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
128-157NSTHEPQKPTVCRKNPKARLPRTIKPKAKVHydrophilic
NLS Segment(s)
PositionSequence
142-154NPKARLPRTIKPK
Subcellular Location(s) extr 20, golg 3, E.R. 2
Family & Domain DBs
KEGG mlr:MELLADRAFT_109694  -  
Amino Acid Sequences MSINRVLSSVFLAVVLLTLAINSGARAFPLDHDDTPRAVKRDLGSVLHKPSNNPETAQIARPIVSGLSTSTIHKLKPVKNLTVASTEAKPGHAAQSKNSTTSKTPELPNVKPGTKPPKNPTPPKTSTNSTHEPQKPTVCRKNPKARLPRTIKPKAKVHIDSTPLTEKWETYNYYKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.04
4 0.03
5 0.03
6 0.03
7 0.04
8 0.04
9 0.04
10 0.05
11 0.05
12 0.06
13 0.07
14 0.08
15 0.09
16 0.15
17 0.19
18 0.19
19 0.24
20 0.25
21 0.26
22 0.3
23 0.33
24 0.3
25 0.27
26 0.29
27 0.25
28 0.3
29 0.31
30 0.29
31 0.3
32 0.32
33 0.37
34 0.38
35 0.38
36 0.33
37 0.37
38 0.38
39 0.35
40 0.3
41 0.27
42 0.28
43 0.29
44 0.3
45 0.25
46 0.21
47 0.2
48 0.19
49 0.17
50 0.11
51 0.09
52 0.08
53 0.06
54 0.08
55 0.08
56 0.09
57 0.13
58 0.14
59 0.14
60 0.18
61 0.24
62 0.25
63 0.34
64 0.38
65 0.36
66 0.39
67 0.41
68 0.38
69 0.34
70 0.31
71 0.24
72 0.2
73 0.19
74 0.15
75 0.14
76 0.13
77 0.11
78 0.15
79 0.17
80 0.17
81 0.18
82 0.27
83 0.27
84 0.29
85 0.3
86 0.26
87 0.23
88 0.26
89 0.29
90 0.24
91 0.25
92 0.3
93 0.35
94 0.34
95 0.39
96 0.41
97 0.37
98 0.35
99 0.4
100 0.43
101 0.44
102 0.5
103 0.5
104 0.57
105 0.65
106 0.73
107 0.72
108 0.71
109 0.7
110 0.67
111 0.66
112 0.61
113 0.58
114 0.56
115 0.55
116 0.48
117 0.53
118 0.54
119 0.53
120 0.52
121 0.54
122 0.54
123 0.58
124 0.66
125 0.66
126 0.7
127 0.76
128 0.82
129 0.83
130 0.86
131 0.87
132 0.85
133 0.87
134 0.85
135 0.83
136 0.82
137 0.84
138 0.82
139 0.79
140 0.78
141 0.75
142 0.76
143 0.73
144 0.69
145 0.66
146 0.63
147 0.57
148 0.54
149 0.53
150 0.43
151 0.42
152 0.36
153 0.29
154 0.29
155 0.33
156 0.32