Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S2K679

Protein Details
Accession S2K679    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
33-66VKSQCPKVAKQEKKKPKTGRAKKRQVYNRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
38-56PKVAKQEKKKPKTGRAKKR
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MVNFTQPMHRCIDPSINTQQGKVHGSLARAGKVKSQCPKVAKQEKKKPKTGRAKKRQVYNRRFVNVTTQVGGKRRMNPAPTAGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.39
3 0.42
4 0.42
5 0.41
6 0.4
7 0.35
8 0.35
9 0.3
10 0.27
11 0.22
12 0.22
13 0.26
14 0.26
15 0.26
16 0.25
17 0.25
18 0.26
19 0.28
20 0.32
21 0.34
22 0.38
23 0.39
24 0.41
25 0.47
26 0.52
27 0.59
28 0.62
29 0.66
30 0.71
31 0.77
32 0.79
33 0.83
34 0.8
35 0.8
36 0.83
37 0.83
38 0.84
39 0.84
40 0.88
41 0.85
42 0.87
43 0.87
44 0.86
45 0.85
46 0.83
47 0.8
48 0.74
49 0.69
50 0.6
51 0.58
52 0.54
53 0.47
54 0.39
55 0.34
56 0.33
57 0.36
58 0.42
59 0.38
60 0.38
61 0.43
62 0.48
63 0.49
64 0.49