Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2J7S9

Protein Details
Accession S2J7S9    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
15-44FKGGESASIKKKKKKSSKSSKEKMDRALREBasic
NLS Segment(s)
PositionSequence
10-38KGSLKFKGGESASIKKKKKKSSKSSKEKM
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MSSAYDHVKKGSLKFKGGESASIKKKKKKSSKSSKEKMDRALREEQIKLKQVYQDVEKTEAERKFEEIKRQRQMERVSKAAAKSHKDRVQEFNHKLEQLSEHHDIPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.46
4 0.43
5 0.43
6 0.39
7 0.43
8 0.48
9 0.55
10 0.59
11 0.6
12 0.68
13 0.72
14 0.78
15 0.8
16 0.82
17 0.84
18 0.89
19 0.92
20 0.92
21 0.92
22 0.91
23 0.84
24 0.82
25 0.8
26 0.72
27 0.66
28 0.64
29 0.56
30 0.5
31 0.47
32 0.43
33 0.38
34 0.39
35 0.35
36 0.3
37 0.29
38 0.27
39 0.27
40 0.25
41 0.24
42 0.2
43 0.22
44 0.2
45 0.2
46 0.24
47 0.24
48 0.23
49 0.2
50 0.22
51 0.27
52 0.29
53 0.38
54 0.41
55 0.48
56 0.54
57 0.58
58 0.58
59 0.57
60 0.63
61 0.62
62 0.58
63 0.52
64 0.47
65 0.45
66 0.45
67 0.44
68 0.42
69 0.38
70 0.39
71 0.46
72 0.48
73 0.5
74 0.52
75 0.54
76 0.58
77 0.62
78 0.61
79 0.58
80 0.58
81 0.54
82 0.51
83 0.45
84 0.38
85 0.32
86 0.34
87 0.31
88 0.29
89 0.3
90 0.32
91 0.3