Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S2J1I5

Protein Details
Accession S2J1I5    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-25LTSALRQKKQARNEVSKLRRNKDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 7.5, cyto_nucl 5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022036  DUF3605  
Pfam View protein in Pfam  
PF12239  DUF3605  
Amino Acid Sequences MLLTSALRQKKQARNEVSKLRRNKDAQAVYQKWTQDTLQTYGSVEKFLLKEKLIWPKDDPEPILVLPNDFPYSVDPGIEHVLIWSKAPLAADFVESVLDERFGAHIWEWIYFVNPPQWQSIPTLPHVHVFMRKRSSIPTTTTTTTTTTHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.78
3 0.81
4 0.81
5 0.82
6 0.81
7 0.76
8 0.75
9 0.7
10 0.68
11 0.67
12 0.64
13 0.63
14 0.65
15 0.63
16 0.57
17 0.57
18 0.52
19 0.42
20 0.38
21 0.3
22 0.24
23 0.25
24 0.24
25 0.22
26 0.21
27 0.21
28 0.23
29 0.22
30 0.18
31 0.14
32 0.14
33 0.14
34 0.16
35 0.18
36 0.15
37 0.18
38 0.22
39 0.32
40 0.31
41 0.33
42 0.32
43 0.34
44 0.37
45 0.36
46 0.32
47 0.23
48 0.23
49 0.21
50 0.21
51 0.17
52 0.14
53 0.11
54 0.12
55 0.11
56 0.09
57 0.1
58 0.08
59 0.11
60 0.11
61 0.1
62 0.09
63 0.1
64 0.11
65 0.1
66 0.09
67 0.06
68 0.08
69 0.08
70 0.08
71 0.07
72 0.06
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.08
79 0.08
80 0.08
81 0.07
82 0.07
83 0.07
84 0.06
85 0.06
86 0.05
87 0.05
88 0.05
89 0.06
90 0.07
91 0.06
92 0.09
93 0.09
94 0.1
95 0.1
96 0.1
97 0.11
98 0.1
99 0.12
100 0.14
101 0.15
102 0.16
103 0.19
104 0.2
105 0.2
106 0.24
107 0.28
108 0.25
109 0.28
110 0.31
111 0.28
112 0.3
113 0.3
114 0.29
115 0.31
116 0.33
117 0.37
118 0.39
119 0.4
120 0.4
121 0.43
122 0.47
123 0.44
124 0.45
125 0.42
126 0.42
127 0.43
128 0.43
129 0.4
130 0.36