Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2IX98

Protein Details
Accession S2IX98   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-33IPKTRNTYCKGSKCRKHTPHKVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MDVNIPKTRNTYCKGSKCRKHTPHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLECTACKYKMQLAIKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.74
3 0.77
4 0.79
5 0.85
6 0.86
7 0.87
8 0.88
9 0.87
10 0.87
11 0.89
12 0.89
13 0.81
14 0.81
15 0.78
16 0.71
17 0.65
18 0.57
19 0.46
20 0.39
21 0.37
22 0.36
23 0.31
24 0.29
25 0.34
26 0.38
27 0.42
28 0.47
29 0.52
30 0.48
31 0.55
32 0.62
33 0.59
34 0.61
35 0.59
36 0.58
37 0.57
38 0.59
39 0.5
40 0.44
41 0.4
42 0.33
43 0.35
44 0.36
45 0.35
46 0.3
47 0.37
48 0.41
49 0.5
50 0.58
51 0.61
52 0.61
53 0.64
54 0.71
55 0.72
56 0.71
57 0.67
58 0.62
59 0.59
60 0.58
61 0.52
62 0.48
63 0.45
64 0.39
65 0.33
66 0.31
67 0.3
68 0.34
69 0.4
70 0.42
71 0.46
72 0.56
73 0.63
74 0.67
75 0.65
76 0.59
77 0.55
78 0.5
79 0.49
80 0.49
81 0.5
82 0.51
83 0.54
84 0.51
85 0.49
86 0.48
87 0.42