Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2JMJ4

Protein Details
Accession S2JMJ4   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
86-112LLDEKKQKQKTTKPVNRQYHRKQSREAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 3.5, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLSTLVRSSRPLLHHNLPRASYIHSCAIIRNVASESTTPTPTTPTTQRKPSSAPKGTVLKGIQYLKDKQDPVALDDSEYPEWLWDLLDEKKQKQKTTKPVNRQYHRKQSREAIKAMNFMKDKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.56
3 0.57
4 0.52
5 0.5
6 0.46
7 0.43
8 0.37
9 0.33
10 0.29
11 0.26
12 0.25
13 0.24
14 0.25
15 0.22
16 0.2
17 0.17
18 0.15
19 0.13
20 0.14
21 0.13
22 0.15
23 0.16
24 0.17
25 0.16
26 0.15
27 0.18
28 0.18
29 0.22
30 0.26
31 0.32
32 0.36
33 0.44
34 0.46
35 0.46
36 0.5
37 0.55
38 0.57
39 0.53
40 0.49
41 0.46
42 0.49
43 0.47
44 0.46
45 0.37
46 0.28
47 0.27
48 0.26
49 0.24
50 0.22
51 0.24
52 0.23
53 0.28
54 0.27
55 0.23
56 0.26
57 0.23
58 0.23
59 0.24
60 0.2
61 0.16
62 0.17
63 0.19
64 0.15
65 0.15
66 0.12
67 0.09
68 0.09
69 0.08
70 0.07
71 0.05
72 0.08
73 0.1
74 0.17
75 0.2
76 0.24
77 0.32
78 0.37
79 0.43
80 0.5
81 0.57
82 0.61
83 0.7
84 0.76
85 0.78
86 0.84
87 0.89
88 0.89
89 0.9
90 0.9
91 0.9
92 0.89
93 0.83
94 0.79
95 0.78
96 0.79
97 0.75
98 0.69
99 0.66
100 0.6
101 0.62
102 0.57
103 0.55
104 0.48