Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S2JRF0

Protein Details
Accession S2JRF0    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGKRKTKRKPQKKLKDKLDTQFNCBasic
NLS Segment(s)
PositionSequence
3-15KRKTKRKPQKKLK
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKTKRKPQKKLKDKLDTQFNCLFCNHENSIECKIDSANKVGILTCKICSVSWQCPVTYLDEPVDVYSAWIDACEDVNQQRRMKAAQKSRESRDDSRSPPPQNYSEDRLDPFDEDDDDDDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.94
3 0.91
4 0.89
5 0.88
6 0.79
7 0.75
8 0.7
9 0.6
10 0.5
11 0.42
12 0.36
13 0.27
14 0.31
15 0.26
16 0.24
17 0.25
18 0.27
19 0.32
20 0.31
21 0.29
22 0.23
23 0.22
24 0.22
25 0.22
26 0.21
27 0.18
28 0.17
29 0.17
30 0.17
31 0.18
32 0.16
33 0.15
34 0.13
35 0.12
36 0.12
37 0.12
38 0.15
39 0.18
40 0.2
41 0.25
42 0.26
43 0.25
44 0.26
45 0.27
46 0.27
47 0.23
48 0.2
49 0.14
50 0.13
51 0.13
52 0.11
53 0.11
54 0.07
55 0.06
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.07
65 0.11
66 0.19
67 0.24
68 0.25
69 0.26
70 0.27
71 0.3
72 0.36
73 0.41
74 0.43
75 0.48
76 0.56
77 0.62
78 0.66
79 0.71
80 0.71
81 0.67
82 0.66
83 0.64
84 0.59
85 0.61
86 0.63
87 0.6
88 0.58
89 0.58
90 0.54
91 0.53
92 0.54
93 0.51
94 0.48
95 0.48
96 0.45
97 0.43
98 0.4
99 0.35
100 0.31
101 0.27
102 0.22
103 0.2