Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2IY86

Protein Details
Accession S2IY86   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
25-48WDDTMQKWRKCQRQSNSRSRRATTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11.166, mito_nucl 9.666, cyto 5.5, cyto_pero 4.166, mito 3.5
Family & Domain DBs
Amino Acid Sequences MSSRFYHEDGQGKVVDELGNDAMDWDDTMQKWRKCQRQSNSRSRRATTNIQTNLNIKKSTVHNFLKTECNLSLNRVTIRPVSRDDTTKIAARLDWVKHWTMTDMNYLRNCVLVGESAFNINM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.21
3 0.15
4 0.15
5 0.13
6 0.11
7 0.09
8 0.1
9 0.08
10 0.08
11 0.08
12 0.06
13 0.08
14 0.08
15 0.15
16 0.23
17 0.25
18 0.33
19 0.42
20 0.5
21 0.56
22 0.66
23 0.69
24 0.72
25 0.8
26 0.84
27 0.85
28 0.86
29 0.82
30 0.75
31 0.7
32 0.65
33 0.63
34 0.59
35 0.58
36 0.53
37 0.5
38 0.49
39 0.47
40 0.45
41 0.39
42 0.32
43 0.23
44 0.22
45 0.24
46 0.28
47 0.32
48 0.31
49 0.32
50 0.33
51 0.35
52 0.37
53 0.33
54 0.31
55 0.23
56 0.23
57 0.2
58 0.21
59 0.21
60 0.19
61 0.19
62 0.17
63 0.18
64 0.2
65 0.22
66 0.22
67 0.23
68 0.25
69 0.26
70 0.29
71 0.29
72 0.29
73 0.29
74 0.3
75 0.28
76 0.24
77 0.22
78 0.22
79 0.25
80 0.24
81 0.25
82 0.25
83 0.26
84 0.26
85 0.26
86 0.25
87 0.22
88 0.21
89 0.26
90 0.25
91 0.29
92 0.3
93 0.31
94 0.29
95 0.27
96 0.26
97 0.17
98 0.16
99 0.13
100 0.13
101 0.13
102 0.14