Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2JBZ2

Protein Details
Accession S2JBZ2   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
198-217NDKQRQQKEALKNSKKAKGKHydrophilic
NLS Segment(s)
PositionSequence
209-221KNSKKAKGKVQPA
Subcellular Location(s) nucl 12.5, cyto_nucl 11.333, cyto 9, cyto_pero 6.333, pero 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023194  eIF3-like_dom_sf  
IPR013906  eIF3j  
Gene Ontology GO:0005852  C:eukaryotic translation initiation factor 3 complex  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF08597  eIF3_subunit  
Amino Acid Sequences MSDWEEEFDEEVVVNTKPKMSWDDEDSDDNNNVKESWDDSEEEEEQEVEQKKVEKKPEATTTAPPAKKMTLKQKIAEKEAALKEQKAKKIALANRFMEGETEEERFERAQQEAGIKKAEFQGEEETPKKAPSKPVESLKPRYKSEFEEFQKLLTDLILEQKNNPLYASFLDQFAKDIAQPAKDMDVRKAASSLTALANDKQRQQKEALKNSKKAKGKVQPAKAAPAAPTREYSTTYDDFDDFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.13
4 0.13
5 0.16
6 0.2
7 0.24
8 0.28
9 0.31
10 0.35
11 0.37
12 0.4
13 0.39
14 0.37
15 0.34
16 0.31
17 0.26
18 0.22
19 0.19
20 0.16
21 0.16
22 0.14
23 0.15
24 0.16
25 0.17
26 0.18
27 0.22
28 0.22
29 0.22
30 0.2
31 0.17
32 0.14
33 0.19
34 0.2
35 0.15
36 0.17
37 0.22
38 0.27
39 0.34
40 0.41
41 0.42
42 0.45
43 0.52
44 0.57
45 0.57
46 0.54
47 0.52
48 0.53
49 0.55
50 0.51
51 0.45
52 0.4
53 0.38
54 0.4
55 0.42
56 0.45
57 0.46
58 0.49
59 0.53
60 0.58
61 0.6
62 0.59
63 0.55
64 0.45
65 0.43
66 0.41
67 0.41
68 0.35
69 0.32
70 0.35
71 0.38
72 0.41
73 0.36
74 0.34
75 0.32
76 0.39
77 0.43
78 0.42
79 0.43
80 0.4
81 0.38
82 0.38
83 0.34
84 0.27
85 0.22
86 0.17
87 0.12
88 0.12
89 0.11
90 0.1
91 0.11
92 0.11
93 0.11
94 0.1
95 0.09
96 0.09
97 0.1
98 0.15
99 0.16
100 0.17
101 0.18
102 0.16
103 0.17
104 0.18
105 0.18
106 0.13
107 0.13
108 0.16
109 0.15
110 0.19
111 0.19
112 0.17
113 0.17
114 0.18
115 0.19
116 0.17
117 0.23
118 0.26
119 0.32
120 0.36
121 0.42
122 0.49
123 0.53
124 0.6
125 0.61
126 0.61
127 0.56
128 0.54
129 0.5
130 0.48
131 0.47
132 0.48
133 0.43
134 0.45
135 0.43
136 0.39
137 0.38
138 0.32
139 0.26
140 0.16
141 0.14
142 0.07
143 0.13
144 0.15
145 0.14
146 0.14
147 0.19
148 0.2
149 0.2
150 0.19
151 0.14
152 0.13
153 0.14
154 0.18
155 0.14
156 0.15
157 0.15
158 0.15
159 0.16
160 0.15
161 0.14
162 0.09
163 0.14
164 0.14
165 0.14
166 0.15
167 0.15
168 0.19
169 0.22
170 0.23
171 0.2
172 0.26
173 0.26
174 0.26
175 0.26
176 0.21
177 0.19
178 0.18
179 0.18
180 0.12
181 0.14
182 0.15
183 0.18
184 0.25
185 0.27
186 0.33
187 0.39
188 0.4
189 0.4
190 0.45
191 0.51
192 0.54
193 0.62
194 0.66
195 0.67
196 0.73
197 0.78
198 0.8
199 0.79
200 0.74
201 0.73
202 0.72
203 0.75
204 0.76
205 0.78
206 0.78
207 0.73
208 0.75
209 0.67
210 0.59
211 0.51
212 0.49
213 0.44
214 0.37
215 0.37
216 0.35
217 0.35
218 0.36
219 0.36
220 0.35
221 0.33
222 0.33
223 0.32