Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S2J807

Protein Details
Accession S2J807    Localization Confidence High Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
29-48LSAGKIKKKIRDTQRMIGKKHydrophilic
87-108AVKHFERKKAERKLKQAKKALEBasic
NLS Segment(s)
PositionSequence
31-39AGKIKKKIR
91-106FERKKAERKLKQAKKA
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MKVQQRKDSKANANTKFTRNRGSKESIPLSAGKIKKKIRDTQRMIGKKDLPANLLTEAKRRLRVLEFDLGEKIIDDHERDNAAKYHAVKHFERKKAERKLKQAKKALETESKKEDADPAKIARLEETVTEMEIKLLYTKNYPKTVPYISLFPQENENDSKSLARKTKLLEEIKQALADGDEDLTLLKKRYRDSYKEKLIERKIIQPVAPVDIEEMQVDKKEDDDNSSDSGDNQDDFFEKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.76
3 0.75
4 0.69
5 0.69
6 0.65
7 0.64
8 0.62
9 0.64
10 0.61
11 0.61
12 0.61
13 0.53
14 0.49
15 0.45
16 0.42
17 0.42
18 0.41
19 0.38
20 0.43
21 0.47
22 0.53
23 0.59
24 0.64
25 0.67
26 0.74
27 0.75
28 0.76
29 0.8
30 0.8
31 0.76
32 0.73
33 0.67
34 0.61
35 0.59
36 0.52
37 0.44
38 0.37
39 0.35
40 0.31
41 0.32
42 0.27
43 0.26
44 0.3
45 0.32
46 0.35
47 0.34
48 0.34
49 0.33
50 0.36
51 0.36
52 0.38
53 0.35
54 0.32
55 0.32
56 0.28
57 0.24
58 0.2
59 0.15
60 0.09
61 0.09
62 0.09
63 0.09
64 0.11
65 0.13
66 0.13
67 0.15
68 0.15
69 0.16
70 0.18
71 0.18
72 0.23
73 0.25
74 0.3
75 0.3
76 0.39
77 0.46
78 0.49
79 0.55
80 0.55
81 0.61
82 0.67
83 0.76
84 0.73
85 0.75
86 0.8
87 0.81
88 0.83
89 0.81
90 0.75
91 0.7
92 0.67
93 0.61
94 0.6
95 0.54
96 0.49
97 0.46
98 0.42
99 0.37
100 0.32
101 0.32
102 0.25
103 0.24
104 0.22
105 0.19
106 0.2
107 0.2
108 0.2
109 0.16
110 0.14
111 0.12
112 0.09
113 0.11
114 0.09
115 0.08
116 0.09
117 0.08
118 0.07
119 0.07
120 0.07
121 0.06
122 0.07
123 0.08
124 0.11
125 0.17
126 0.21
127 0.24
128 0.25
129 0.25
130 0.29
131 0.3
132 0.29
133 0.26
134 0.24
135 0.23
136 0.28
137 0.27
138 0.23
139 0.26
140 0.22
141 0.24
142 0.23
143 0.23
144 0.18
145 0.18
146 0.2
147 0.18
148 0.24
149 0.26
150 0.25
151 0.27
152 0.29
153 0.36
154 0.42
155 0.45
156 0.42
157 0.44
158 0.46
159 0.44
160 0.41
161 0.33
162 0.24
163 0.2
164 0.17
165 0.1
166 0.06
167 0.05
168 0.05
169 0.05
170 0.07
171 0.08
172 0.1
173 0.12
174 0.15
175 0.19
176 0.28
177 0.37
178 0.44
179 0.52
180 0.6
181 0.68
182 0.71
183 0.74
184 0.74
185 0.72
186 0.72
187 0.66
188 0.64
189 0.6
190 0.56
191 0.51
192 0.47
193 0.42
194 0.37
195 0.34
196 0.26
197 0.21
198 0.19
199 0.19
200 0.15
201 0.14
202 0.11
203 0.13
204 0.15
205 0.13
206 0.13
207 0.16
208 0.17
209 0.2
210 0.23
211 0.24
212 0.25
213 0.26
214 0.25
215 0.22
216 0.24
217 0.22
218 0.19
219 0.16
220 0.15