Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2J404

Protein Details
Accession S2J404   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
122-151DEEIKKSDKPSLKSKKKKTKSKPTSSLLSFHydrophilic
NLS Segment(s)
PositionSequence
126-143KKSDKPSLKSKKKKTKSK
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MPPKRNLTPKQLSNSLSYVQKEAPFLARLKNQNQEKEKAARKFENYEDGQDDDDYNELDGAQVVELDAKGREIFKKQDEDEEKEEKEEESKEPEAPAVDENGRLLFRKQTTSTKRKLQSIIDEEIKKSDKPSLKSKKKKTKSKPTSSLLSFEQDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.51
3 0.46
4 0.4
5 0.35
6 0.31
7 0.31
8 0.28
9 0.26
10 0.26
11 0.24
12 0.24
13 0.27
14 0.31
15 0.35
16 0.39
17 0.46
18 0.49
19 0.55
20 0.59
21 0.58
22 0.56
23 0.59
24 0.62
25 0.6
26 0.6
27 0.56
28 0.55
29 0.56
30 0.53
31 0.52
32 0.45
33 0.42
34 0.37
35 0.32
36 0.29
37 0.24
38 0.22
39 0.14
40 0.13
41 0.1
42 0.08
43 0.06
44 0.05
45 0.05
46 0.04
47 0.04
48 0.04
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.04
56 0.05
57 0.06
58 0.08
59 0.1
60 0.14
61 0.17
62 0.21
63 0.21
64 0.29
65 0.32
66 0.36
67 0.38
68 0.38
69 0.35
70 0.31
71 0.31
72 0.23
73 0.21
74 0.17
75 0.14
76 0.15
77 0.16
78 0.16
79 0.16
80 0.16
81 0.15
82 0.14
83 0.13
84 0.11
85 0.1
86 0.1
87 0.1
88 0.1
89 0.11
90 0.1
91 0.11
92 0.14
93 0.15
94 0.2
95 0.23
96 0.32
97 0.41
98 0.49
99 0.55
100 0.59
101 0.63
102 0.64
103 0.65
104 0.6
105 0.59
106 0.57
107 0.56
108 0.54
109 0.5
110 0.45
111 0.45
112 0.42
113 0.33
114 0.3
115 0.32
116 0.31
117 0.35
118 0.45
119 0.52
120 0.61
121 0.71
122 0.8
123 0.84
124 0.87
125 0.94
126 0.94
127 0.94
128 0.94
129 0.94
130 0.93
131 0.88
132 0.87
133 0.79
134 0.72
135 0.64
136 0.58