Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2JFY2

Protein Details
Accession S2JFY2   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
62-87LTEQTDIKNRRRSRKGKKWPQLEEAVHydrophilic
NLS Segment(s)
PositionSequence
69-79KNRRRSRKGKK
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MKRTNASLSIQNHFEICELKKKKPSWWTNVQLAMWAEEKYNLPKAPDSSTVSKILKRGEQGLTEQTDIKNRRRSRKGKKWPQLEEAVIVWVNVAKNNKIPINWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.2
4 0.26
5 0.28
6 0.33
7 0.41
8 0.43
9 0.5
10 0.57
11 0.63
12 0.61
13 0.67
14 0.68
15 0.66
16 0.68
17 0.6
18 0.52
19 0.44
20 0.37
21 0.28
22 0.22
23 0.16
24 0.13
25 0.14
26 0.14
27 0.17
28 0.16
29 0.16
30 0.18
31 0.19
32 0.21
33 0.24
34 0.26
35 0.25
36 0.27
37 0.3
38 0.3
39 0.29
40 0.28
41 0.26
42 0.24
43 0.22
44 0.23
45 0.2
46 0.2
47 0.21
48 0.22
49 0.22
50 0.2
51 0.2
52 0.17
53 0.23
54 0.26
55 0.31
56 0.37
57 0.42
58 0.52
59 0.61
60 0.71
61 0.74
62 0.82
63 0.86
64 0.88
65 0.91
66 0.91
67 0.88
68 0.84
69 0.79
70 0.69
71 0.6
72 0.49
73 0.42
74 0.32
75 0.25
76 0.18
77 0.14
78 0.13
79 0.14
80 0.17
81 0.16
82 0.2
83 0.27
84 0.29