Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2K4F9

Protein Details
Accession S2K4F9    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
22-45REQARAKNLKKKEKESKGKTNLNGHydrophilic
NLS Segment(s)
PositionSequence
26-40RAKNLKKKEKESKGK
Subcellular Location(s) nucl 13, mito 7.5, cyto_mito 6.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007513  SERF-like_N  
Pfam View protein in Pfam  
PF04419  4F5  
Amino Acid Sequences MFAIKSKISLSSLFYQQGGNQREQARAKNLKKKEKESKGKTNLNGQSINQKKESDAAIMRAKQEAALAKKQAEAAAGGGAAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.26
4 0.33
5 0.31
6 0.28
7 0.3
8 0.31
9 0.37
10 0.39
11 0.4
12 0.4
13 0.47
14 0.53
15 0.56
16 0.63
17 0.67
18 0.71
19 0.76
20 0.78
21 0.78
22 0.81
23 0.81
24 0.83
25 0.82
26 0.81
27 0.73
28 0.72
29 0.65
30 0.58
31 0.5
32 0.4
33 0.41
34 0.4
35 0.4
36 0.33
37 0.3
38 0.26
39 0.28
40 0.28
41 0.22
42 0.18
43 0.21
44 0.24
45 0.26
46 0.26
47 0.25
48 0.23
49 0.2
50 0.21
51 0.22
52 0.22
53 0.26
54 0.28
55 0.28
56 0.3
57 0.31
58 0.28
59 0.23
60 0.19
61 0.14
62 0.12
63 0.11