Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2JUC7

Protein Details
Accession S2JUC7    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
124-146QTVRSVSKKTSQKRKADGEKTSAHydrophilic
NLS Segment(s)
PositionSequence
132-150KTSQKRKADGEKTSAKKPK
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MADNKKEGKKASSRLLGMKFMQRSMEKEMQEQLEKERKRVISEAEWVLDTKDTTIQKPKIHIEVQPSFLPFTQDTTAGRRSFKSFNKLVEANADQEEKSQRLAREEKAEEATRISDKEFGKQMQTVRSVSKKTSQKRKADGEKTSAKKPKMASNTFIKPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.58
4 0.52
5 0.52
6 0.45
7 0.38
8 0.4
9 0.35
10 0.35
11 0.38
12 0.42
13 0.35
14 0.36
15 0.39
16 0.38
17 0.39
18 0.36
19 0.36
20 0.38
21 0.38
22 0.38
23 0.4
24 0.37
25 0.38
26 0.4
27 0.37
28 0.32
29 0.37
30 0.37
31 0.31
32 0.3
33 0.26
34 0.24
35 0.19
36 0.15
37 0.1
38 0.13
39 0.13
40 0.16
41 0.24
42 0.28
43 0.3
44 0.34
45 0.36
46 0.36
47 0.37
48 0.37
49 0.36
50 0.35
51 0.36
52 0.33
53 0.3
54 0.26
55 0.24
56 0.24
57 0.16
58 0.16
59 0.13
60 0.13
61 0.13
62 0.16
63 0.21
64 0.2
65 0.21
66 0.19
67 0.22
68 0.27
69 0.3
70 0.33
71 0.31
72 0.31
73 0.35
74 0.34
75 0.31
76 0.29
77 0.27
78 0.22
79 0.21
80 0.19
81 0.14
82 0.16
83 0.18
84 0.14
85 0.15
86 0.17
87 0.16
88 0.21
89 0.25
90 0.27
91 0.32
92 0.33
93 0.33
94 0.34
95 0.35
96 0.29
97 0.27
98 0.26
99 0.2
100 0.19
101 0.17
102 0.19
103 0.18
104 0.22
105 0.25
106 0.25
107 0.26
108 0.29
109 0.31
110 0.3
111 0.33
112 0.31
113 0.32
114 0.37
115 0.37
116 0.36
117 0.42
118 0.46
119 0.52
120 0.61
121 0.65
122 0.68
123 0.74
124 0.82
125 0.84
126 0.84
127 0.8
128 0.77
129 0.78
130 0.74
131 0.75
132 0.73
133 0.64
134 0.61
135 0.58
136 0.59
137 0.6
138 0.6
139 0.56
140 0.58