Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2KCG5

Protein Details
Accession S2KCG5    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
27-52TTTASPVKNKSTKKRNRTVKLPEDEEHydrophilic
NLS Segment(s)
PositionSequence
38-44TKKRNRT
Subcellular Location(s) nucl 24.5, mito_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000837  AP-1  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
CDD cd14687  bZIP_ATF2  
Amino Acid Sequences MMPMQPSQPQSQLQPQQRSFIPTPNTTTTASPVKNKSTKKRNRTVKLPEDEEKRKNFLERNRIAALKCRQRKKQWLSNLQNRVEYLTNDNDQLQMEANALRKEIMDLKTLLVAHKDCPQYNAALMTKNNYANLLPQQQPVYHQHFSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.56
3 0.57
4 0.56
5 0.59
6 0.51
7 0.49
8 0.46
9 0.39
10 0.43
11 0.43
12 0.44
13 0.38
14 0.37
15 0.34
16 0.35
17 0.35
18 0.35
19 0.35
20 0.41
21 0.46
22 0.53
23 0.59
24 0.63
25 0.71
26 0.74
27 0.8
28 0.83
29 0.83
30 0.85
31 0.85
32 0.84
33 0.81
34 0.77
35 0.73
36 0.71
37 0.7
38 0.66
39 0.59
40 0.52
41 0.46
42 0.44
43 0.43
44 0.42
45 0.46
46 0.42
47 0.45
48 0.44
49 0.45
50 0.41
51 0.43
52 0.44
53 0.43
54 0.48
55 0.5
56 0.55
57 0.6
58 0.7
59 0.7
60 0.71
61 0.71
62 0.75
63 0.76
64 0.78
65 0.79
66 0.7
67 0.63
68 0.54
69 0.47
70 0.37
71 0.29
72 0.23
73 0.19
74 0.18
75 0.17
76 0.17
77 0.15
78 0.14
79 0.14
80 0.11
81 0.08
82 0.08
83 0.09
84 0.12
85 0.11
86 0.11
87 0.11
88 0.1
89 0.12
90 0.17
91 0.16
92 0.16
93 0.17
94 0.17
95 0.19
96 0.2
97 0.19
98 0.17
99 0.16
100 0.15
101 0.22
102 0.25
103 0.23
104 0.25
105 0.26
106 0.24
107 0.25
108 0.28
109 0.23
110 0.23
111 0.23
112 0.24
113 0.28
114 0.28
115 0.27
116 0.23
117 0.22
118 0.22
119 0.28
120 0.31
121 0.29
122 0.31
123 0.33
124 0.33
125 0.37
126 0.4
127 0.41