Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S2IXT1

Protein Details
Accession S2IXT1    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAKEKIQKKSPKKMSPYNQFMKTHydrophilic
46-74QNWSKSPENPKNKKEEKKEEKKEEKAAETHydrophilic
NLS Segment(s)
PositionSequence
54-70NPKNKKEEKKEEKKEEK
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 6, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
IPR006780  YABBY  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04690  YABBY  
Amino Acid Sequences MAKEKIQKKSPKKMSPYNQFMKTELAKVKEANAGIAHKDAFKMAAQNWSKSPENPKNKKEEKKEEKKEEKAAETTEEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.86
4 0.83
5 0.79
6 0.71
7 0.64
8 0.59
9 0.49
10 0.45
11 0.39
12 0.34
13 0.29
14 0.28
15 0.28
16 0.26
17 0.24
18 0.2
19 0.17
20 0.15
21 0.14
22 0.14
23 0.13
24 0.1
25 0.1
26 0.08
27 0.08
28 0.07
29 0.08
30 0.08
31 0.17
32 0.18
33 0.2
34 0.21
35 0.26
36 0.27
37 0.28
38 0.37
39 0.38
40 0.48
41 0.55
42 0.59
43 0.65
44 0.73
45 0.8
46 0.8
47 0.82
48 0.82
49 0.84
50 0.9
51 0.9
52 0.9
53 0.89
54 0.88
55 0.83
56 0.77
57 0.7
58 0.61