Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S2JHV6

Protein Details
Accession S2JHV6    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
68-94HWFRLKTDTKIRWNAKRRNWRHTKLNIHydrophilic
NLS Segment(s)
PositionSequence
55-88KLGKAKKQNRPLPHWFRLKTDTKIRWNAKRRNWR
Subcellular Location(s) nucl 16, mito 6, pero 2, cyto 1, plas 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MNVDLGETCHKPHQKCEPTNVFFFHLIRIQKWYTILHGSTIIIFPSQKSFITKVKLGKAKKQNRPLPHWFRLKTDTKIRWNAKRRNWRHTKLNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.58
3 0.66
4 0.67
5 0.65
6 0.67
7 0.61
8 0.53
9 0.45
10 0.4
11 0.33
12 0.28
13 0.25
14 0.22
15 0.25
16 0.22
17 0.21
18 0.23
19 0.21
20 0.19
21 0.2
22 0.2
23 0.16
24 0.16
25 0.15
26 0.13
27 0.13
28 0.1
29 0.07
30 0.07
31 0.06
32 0.08
33 0.09
34 0.08
35 0.1
36 0.13
37 0.17
38 0.2
39 0.24
40 0.26
41 0.32
42 0.39
43 0.4
44 0.46
45 0.53
46 0.59
47 0.65
48 0.71
49 0.72
50 0.72
51 0.78
52 0.79
53 0.78
54 0.76
55 0.77
56 0.68
57 0.66
58 0.65
59 0.64
60 0.6
61 0.61
62 0.61
63 0.6
64 0.68
65 0.72
66 0.74
67 0.78
68 0.81
69 0.82
70 0.85
71 0.84
72 0.85
73 0.87
74 0.86