Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R8BSP2

Protein Details
Accession R8BSP2    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-39RFLWEKASPKPWKKRYKYPYESQMKRRNSHydrophilic
NLS Segment(s)
PositionSequence
20-26KPWKKRY
51-62KAHGLEKKPFKK
Subcellular Location(s) nucl 13mito_nucl 13, mito 11
Family & Domain DBs
KEGG tmn:UCRPA7_2147  -  
Amino Acid Sequences MGRRLHCKTARFLWEKASPKPWKKRYKYPYESQMKRRNSPINVKLRWESIKAHGLEKKPFKKFMRLPKELQLKIWNNALSKPGIHFFAVVVTPPDKEWNPMDPHAWKPPFILTDWLCEKKGEFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.59
3 0.57
4 0.58
5 0.58
6 0.63
7 0.73
8 0.75
9 0.77
10 0.8
11 0.86
12 0.86
13 0.87
14 0.86
15 0.84
16 0.84
17 0.84
18 0.84
19 0.83
20 0.83
21 0.78
22 0.74
23 0.72
24 0.7
25 0.65
26 0.67
27 0.66
28 0.66
29 0.61
30 0.61
31 0.55
32 0.51
33 0.47
34 0.39
35 0.33
36 0.27
37 0.32
38 0.29
39 0.31
40 0.32
41 0.33
42 0.37
43 0.44
44 0.46
45 0.43
46 0.5
47 0.48
48 0.53
49 0.56
50 0.6
51 0.61
52 0.59
53 0.58
54 0.59
55 0.67
56 0.58
57 0.53
58 0.51
59 0.44
60 0.42
61 0.43
62 0.36
63 0.28
64 0.29
65 0.28
66 0.2
67 0.18
68 0.17
69 0.15
70 0.14
71 0.13
72 0.12
73 0.11
74 0.12
75 0.11
76 0.1
77 0.11
78 0.1
79 0.1
80 0.11
81 0.15
82 0.13
83 0.17
84 0.19
85 0.23
86 0.28
87 0.29
88 0.33
89 0.33
90 0.37
91 0.44
92 0.43
93 0.37
94 0.34
95 0.37
96 0.34
97 0.32
98 0.35
99 0.26
100 0.32
101 0.39
102 0.41
103 0.37
104 0.36