Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R8BS43

Protein Details
Accession R8BS43   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
156-176IDEQKKTIKKQERDHLRKDNIBasic
NLS Segment(s)
PositionSequence
133-134RK
184-203ILKKSKRIEALIERLGRKPG
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
KEGG tmn:UCRPA7_2298  -  
Amino Acid Sequences MDSATENAAPQAEVRAVEDNSPERGSSEAPIMVEDDEPEAEEGAANNNDSEPQGPGSGSDDPEEEAEVDGRRNDDYQVEQSRVSSQQQDPEGACPNKQCANIQQMLLERIAELERQRAEKDAAHSVEIRELKRKLRKSPEPISESDKLIKDQRAQIDEQKKTIKKQERDHLRKDNIIKQQEKDILKKSKRIEALIERLGRKPGVKNLKTRIVSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.17
3 0.17
4 0.18
5 0.22
6 0.22
7 0.24
8 0.24
9 0.22
10 0.18
11 0.19
12 0.19
13 0.16
14 0.17
15 0.15
16 0.14
17 0.15
18 0.15
19 0.14
20 0.13
21 0.12
22 0.1
23 0.09
24 0.09
25 0.09
26 0.08
27 0.07
28 0.07
29 0.07
30 0.09
31 0.1
32 0.1
33 0.09
34 0.09
35 0.1
36 0.1
37 0.11
38 0.09
39 0.09
40 0.09
41 0.09
42 0.1
43 0.12
44 0.14
45 0.14
46 0.13
47 0.12
48 0.12
49 0.13
50 0.13
51 0.1
52 0.08
53 0.09
54 0.08
55 0.09
56 0.09
57 0.09
58 0.1
59 0.1
60 0.1
61 0.11
62 0.13
63 0.18
64 0.21
65 0.22
66 0.21
67 0.21
68 0.23
69 0.23
70 0.22
71 0.21
72 0.19
73 0.22
74 0.23
75 0.25
76 0.23
77 0.23
78 0.29
79 0.24
80 0.24
81 0.2
82 0.21
83 0.23
84 0.24
85 0.23
86 0.2
87 0.24
88 0.25
89 0.25
90 0.24
91 0.21
92 0.21
93 0.2
94 0.15
95 0.1
96 0.08
97 0.09
98 0.08
99 0.07
100 0.09
101 0.11
102 0.12
103 0.13
104 0.14
105 0.15
106 0.16
107 0.19
108 0.21
109 0.21
110 0.21
111 0.21
112 0.2
113 0.23
114 0.24
115 0.22
116 0.22
117 0.24
118 0.31
119 0.38
120 0.44
121 0.47
122 0.54
123 0.63
124 0.65
125 0.72
126 0.73
127 0.69
128 0.66
129 0.64
130 0.56
131 0.49
132 0.45
133 0.37
134 0.31
135 0.31
136 0.32
137 0.3
138 0.33
139 0.36
140 0.34
141 0.36
142 0.42
143 0.46
144 0.45
145 0.45
146 0.49
147 0.47
148 0.49
149 0.56
150 0.58
151 0.57
152 0.65
153 0.7
154 0.73
155 0.78
156 0.82
157 0.83
158 0.78
159 0.76
160 0.73
161 0.72
162 0.69
163 0.7
164 0.65
165 0.57
166 0.6
167 0.6
168 0.58
169 0.56
170 0.56
171 0.57
172 0.58
173 0.63
174 0.6
175 0.6
176 0.61
177 0.58
178 0.57
179 0.55
180 0.58
181 0.58
182 0.6
183 0.54
184 0.52
185 0.53
186 0.46
187 0.41
188 0.39
189 0.41
190 0.46
191 0.49
192 0.56
193 0.61
194 0.69