Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R8BKW8

Protein Details
Accession R8BKW8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
305-330LAVHRYQQQRKESRARRIQQHVYQQMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 8, mito 3
Family & Domain DBs
KEGG tmn:UCRPA7_4507  -  
Amino Acid Sequences MLKTYIAMRGTHVGFNDSLFEWVNDKERAGRHNNDGEPSESLKDTPRERQEVFLYDRPHGDHIRAPVGHNMELHKLSVKERDEGWHKKVRAADGIPLRDYVSDDEGDPADARISPCTFLEFSDGARRWDADQPEKPEPEDIPLRPTTPDNRPHVHKERVLRYQRDEEDGKTLSAEGNYDSISSMLFTPPEGVSPGMAGYLNRLYLYDRMNANAAPAIQGRLAAPANPFNASAPSGNEYYREDEVKEVISREWKIDPAVVQRNLETKWAEVKENKTEEDRMNGYIERFRHENYQLRPDNEKLHDCLAVHRYQQQRKESRARRIQQHVYQQMQEVDVELEHSKQTLDLAVRTYERIDRENSELLYERDVLLREFGKETPQEVFDMFPDLFKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.24
4 0.18
5 0.17
6 0.16
7 0.16
8 0.15
9 0.17
10 0.22
11 0.2
12 0.2
13 0.24
14 0.27
15 0.34
16 0.39
17 0.43
18 0.46
19 0.53
20 0.55
21 0.54
22 0.52
23 0.48
24 0.43
25 0.41
26 0.35
27 0.27
28 0.25
29 0.27
30 0.31
31 0.33
32 0.38
33 0.44
34 0.48
35 0.48
36 0.52
37 0.51
38 0.52
39 0.54
40 0.51
41 0.46
42 0.41
43 0.42
44 0.39
45 0.39
46 0.34
47 0.3
48 0.28
49 0.29
50 0.34
51 0.33
52 0.32
53 0.33
54 0.35
55 0.34
56 0.32
57 0.3
58 0.27
59 0.27
60 0.26
61 0.24
62 0.22
63 0.23
64 0.29
65 0.28
66 0.26
67 0.27
68 0.33
69 0.39
70 0.44
71 0.48
72 0.49
73 0.48
74 0.49
75 0.52
76 0.48
77 0.46
78 0.41
79 0.42
80 0.4
81 0.42
82 0.39
83 0.36
84 0.33
85 0.26
86 0.26
87 0.2
88 0.16
89 0.13
90 0.13
91 0.14
92 0.13
93 0.14
94 0.12
95 0.1
96 0.09
97 0.1
98 0.1
99 0.11
100 0.12
101 0.12
102 0.12
103 0.15
104 0.14
105 0.13
106 0.17
107 0.14
108 0.15
109 0.23
110 0.24
111 0.22
112 0.23
113 0.23
114 0.21
115 0.26
116 0.3
117 0.29
118 0.34
119 0.39
120 0.44
121 0.44
122 0.42
123 0.39
124 0.34
125 0.31
126 0.31
127 0.25
128 0.24
129 0.24
130 0.24
131 0.23
132 0.26
133 0.26
134 0.28
135 0.35
136 0.36
137 0.39
138 0.43
139 0.51
140 0.56
141 0.57
142 0.54
143 0.54
144 0.56
145 0.61
146 0.64
147 0.59
148 0.56
149 0.58
150 0.55
151 0.52
152 0.46
153 0.38
154 0.34
155 0.31
156 0.26
157 0.18
158 0.17
159 0.13
160 0.11
161 0.1
162 0.06
163 0.06
164 0.06
165 0.06
166 0.06
167 0.05
168 0.05
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.06
175 0.06
176 0.07
177 0.07
178 0.07
179 0.06
180 0.06
181 0.06
182 0.05
183 0.05
184 0.04
185 0.05
186 0.06
187 0.06
188 0.06
189 0.06
190 0.07
191 0.1
192 0.12
193 0.14
194 0.14
195 0.15
196 0.15
197 0.15
198 0.14
199 0.12
200 0.11
201 0.08
202 0.08
203 0.08
204 0.07
205 0.08
206 0.07
207 0.09
208 0.09
209 0.09
210 0.1
211 0.12
212 0.13
213 0.13
214 0.13
215 0.11
216 0.12
217 0.12
218 0.12
219 0.1
220 0.12
221 0.12
222 0.12
223 0.13
224 0.14
225 0.16
226 0.17
227 0.17
228 0.15
229 0.14
230 0.15
231 0.16
232 0.15
233 0.13
234 0.12
235 0.16
236 0.16
237 0.18
238 0.18
239 0.17
240 0.17
241 0.17
242 0.18
243 0.21
244 0.29
245 0.29
246 0.28
247 0.29
248 0.31
249 0.3
250 0.31
251 0.24
252 0.17
253 0.22
254 0.23
255 0.26
256 0.27
257 0.32
258 0.37
259 0.39
260 0.39
261 0.35
262 0.37
263 0.35
264 0.36
265 0.33
266 0.26
267 0.26
268 0.25
269 0.24
270 0.24
271 0.24
272 0.22
273 0.22
274 0.22
275 0.26
276 0.3
277 0.37
278 0.37
279 0.47
280 0.49
281 0.5
282 0.53
283 0.5
284 0.52
285 0.49
286 0.47
287 0.39
288 0.36
289 0.35
290 0.31
291 0.33
292 0.31
293 0.29
294 0.28
295 0.33
296 0.39
297 0.44
298 0.52
299 0.56
300 0.59
301 0.65
302 0.74
303 0.75
304 0.77
305 0.8
306 0.81
307 0.8
308 0.82
309 0.83
310 0.8
311 0.81
312 0.79
313 0.73
314 0.66
315 0.6
316 0.52
317 0.43
318 0.35
319 0.26
320 0.18
321 0.13
322 0.14
323 0.11
324 0.11
325 0.1
326 0.11
327 0.1
328 0.09
329 0.1
330 0.12
331 0.13
332 0.14
333 0.16
334 0.19
335 0.21
336 0.21
337 0.23
338 0.24
339 0.25
340 0.26
341 0.28
342 0.28
343 0.32
344 0.36
345 0.34
346 0.33
347 0.33
348 0.31
349 0.3
350 0.27
351 0.23
352 0.21
353 0.22
354 0.19
355 0.2
356 0.2
357 0.19
358 0.21
359 0.21
360 0.24
361 0.25
362 0.26
363 0.26
364 0.26
365 0.25
366 0.23
367 0.23
368 0.18
369 0.21
370 0.19