Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4REE1

Protein Details
Accession F4REE1    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-22TPKKSIKPTHHQHPSSNWKNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013520  Exonuclease_RNaseT/DNA_pol3  
IPR037431  REX4_DEDDh_dom  
IPR047021  REXO1/3/4-like  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0008408  F:3'-5' exonuclease activity  
GO:0003676  F:nucleic acid binding  
GO:0006364  P:rRNA processing  
KEGG mlr:MELLADRAFT_47550  -  
Pfam View protein in Pfam  
PF00929  RNase_T  
CDD cd06144  REX4_like  
Amino Acid Sequences MRTPKKSIKPTHHQHPSSNWKNIQSKLPKIPASVKAKQALKRQLRINNNVLPNVTPSHNESQDPVSVMLCQILQQGVSRSKLNEIGRFLAIDCEMVGVGPNGSESVLARVSIVNYYGAVLLDSYVSPKEKVTDYRTWVSGITPEHLANASSFSEVTSKVAQLIKDKVLVGHAITNDLQALLLKHPRNLIRDTSKYGPLRVLSGTKFPSLKKLAALLLRLEIQTSSHSSVDDARATMAVYRTQKDEWEASLRPQHSSIAPLFRPPSRPKTVMATPIQPKPTSPPPVAPVASSSKSTPVVNDAKKISNSKETLDQMSPKVTNKPETKGKNIETGGKELSHTNNLGKGNKIKASEVIKDDIGQPNQSPPKVIKSTTPEFKKPRTANLRLSATLQHIRNEQETAEKSASKPPSPSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.8
4 0.78
5 0.78
6 0.72
7 0.7
8 0.72
9 0.71
10 0.7
11 0.68
12 0.68
13 0.68
14 0.71
15 0.65
16 0.63
17 0.66
18 0.65
19 0.65
20 0.63
21 0.6
22 0.6
23 0.64
24 0.66
25 0.68
26 0.69
27 0.7
28 0.71
29 0.73
30 0.74
31 0.76
32 0.77
33 0.75
34 0.73
35 0.68
36 0.62
37 0.55
38 0.47
39 0.4
40 0.36
41 0.29
42 0.23
43 0.25
44 0.29
45 0.31
46 0.3
47 0.3
48 0.3
49 0.31
50 0.31
51 0.26
52 0.19
53 0.17
54 0.16
55 0.15
56 0.12
57 0.1
58 0.09
59 0.09
60 0.09
61 0.1
62 0.15
63 0.19
64 0.21
65 0.23
66 0.22
67 0.25
68 0.31
69 0.34
70 0.33
71 0.33
72 0.33
73 0.32
74 0.31
75 0.29
76 0.24
77 0.2
78 0.15
79 0.11
80 0.08
81 0.07
82 0.07
83 0.07
84 0.05
85 0.05
86 0.05
87 0.05
88 0.04
89 0.05
90 0.05
91 0.05
92 0.07
93 0.08
94 0.08
95 0.08
96 0.09
97 0.1
98 0.1
99 0.1
100 0.08
101 0.07
102 0.08
103 0.08
104 0.07
105 0.06
106 0.06
107 0.05
108 0.05
109 0.05
110 0.06
111 0.07
112 0.08
113 0.09
114 0.09
115 0.12
116 0.14
117 0.2
118 0.26
119 0.31
120 0.35
121 0.38
122 0.38
123 0.37
124 0.34
125 0.29
126 0.26
127 0.21
128 0.17
129 0.15
130 0.14
131 0.14
132 0.14
133 0.14
134 0.1
135 0.11
136 0.1
137 0.08
138 0.08
139 0.08
140 0.09
141 0.09
142 0.11
143 0.1
144 0.09
145 0.12
146 0.14
147 0.15
148 0.17
149 0.2
150 0.2
151 0.2
152 0.2
153 0.17
154 0.16
155 0.16
156 0.12
157 0.12
158 0.11
159 0.11
160 0.1
161 0.1
162 0.09
163 0.09
164 0.08
165 0.06
166 0.07
167 0.07
168 0.13
169 0.14
170 0.15
171 0.19
172 0.23
173 0.25
174 0.27
175 0.31
176 0.31
177 0.33
178 0.37
179 0.36
180 0.4
181 0.38
182 0.36
183 0.32
184 0.26
185 0.24
186 0.21
187 0.2
188 0.14
189 0.18
190 0.18
191 0.18
192 0.2
193 0.18
194 0.24
195 0.24
196 0.23
197 0.2
198 0.2
199 0.21
200 0.21
201 0.22
202 0.16
203 0.14
204 0.14
205 0.14
206 0.12
207 0.09
208 0.08
209 0.08
210 0.1
211 0.11
212 0.1
213 0.1
214 0.11
215 0.13
216 0.14
217 0.13
218 0.11
219 0.09
220 0.09
221 0.09
222 0.1
223 0.09
224 0.12
225 0.14
226 0.15
227 0.17
228 0.17
229 0.18
230 0.19
231 0.19
232 0.17
233 0.2
234 0.19
235 0.2
236 0.26
237 0.26
238 0.24
239 0.24
240 0.23
241 0.18
242 0.21
243 0.2
244 0.21
245 0.2
246 0.22
247 0.24
248 0.25
249 0.31
250 0.33
251 0.39
252 0.39
253 0.41
254 0.4
255 0.44
256 0.46
257 0.47
258 0.45
259 0.44
260 0.42
261 0.46
262 0.47
263 0.4
264 0.36
265 0.35
266 0.4
267 0.39
268 0.36
269 0.34
270 0.34
271 0.39
272 0.39
273 0.33
274 0.28
275 0.28
276 0.27
277 0.25
278 0.23
279 0.21
280 0.23
281 0.22
282 0.2
283 0.21
284 0.28
285 0.29
286 0.33
287 0.33
288 0.35
289 0.38
290 0.41
291 0.38
292 0.38
293 0.37
294 0.35
295 0.39
296 0.37
297 0.38
298 0.38
299 0.38
300 0.31
301 0.34
302 0.34
303 0.29
304 0.33
305 0.32
306 0.38
307 0.39
308 0.44
309 0.49
310 0.52
311 0.58
312 0.59
313 0.58
314 0.58
315 0.56
316 0.57
317 0.5
318 0.48
319 0.43
320 0.35
321 0.33
322 0.28
323 0.29
324 0.25
325 0.25
326 0.22
327 0.26
328 0.29
329 0.31
330 0.33
331 0.35
332 0.37
333 0.39
334 0.4
335 0.36
336 0.38
337 0.41
338 0.42
339 0.4
340 0.37
341 0.33
342 0.33
343 0.35
344 0.36
345 0.33
346 0.29
347 0.27
348 0.33
349 0.39
350 0.38
351 0.37
352 0.32
353 0.39
354 0.41
355 0.42
356 0.4
357 0.42
358 0.51
359 0.57
360 0.62
361 0.62
362 0.65
363 0.71
364 0.74
365 0.69
366 0.71
367 0.72
368 0.72
369 0.72
370 0.74
371 0.73
372 0.64
373 0.63
374 0.56
375 0.52
376 0.52
377 0.45
378 0.39
379 0.37
380 0.4
381 0.39
382 0.37
383 0.31
384 0.32
385 0.33
386 0.35
387 0.35
388 0.33
389 0.33
390 0.4
391 0.45
392 0.41
393 0.42