Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R8BED9

Protein Details
Accession R8BED9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-38VGALRLKGGKVKKHKKKKDKGSDLEKNLSTBasic
NLS Segment(s)
PositionSequence
13-29RLKGGKVKKHKKKKDKG
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
KEGG tmn:UCRPA7_6942  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSDEYASVGALRLKGGKVKKHKKKKDKGSDLEKNLSTGESSKDLEVVKKRKSEEAEDDEATRAKPSEEPEEEEDSVPQHRKTEAERRFEEARRKKLLELSESANSRPELLKTHKERVEELNTYLSKLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.2
3 0.26
4 0.34
5 0.43
6 0.54
7 0.64
8 0.73
9 0.83
10 0.88
11 0.92
12 0.94
13 0.95
14 0.95
15 0.93
16 0.93
17 0.92
18 0.87
19 0.83
20 0.72
21 0.61
22 0.5
23 0.41
24 0.31
25 0.22
26 0.18
27 0.14
28 0.14
29 0.13
30 0.15
31 0.15
32 0.2
33 0.27
34 0.31
35 0.33
36 0.36
37 0.38
38 0.41
39 0.44
40 0.44
41 0.44
42 0.44
43 0.43
44 0.4
45 0.39
46 0.35
47 0.32
48 0.26
49 0.19
50 0.12
51 0.08
52 0.1
53 0.11
54 0.17
55 0.18
56 0.21
57 0.24
58 0.28
59 0.28
60 0.26
61 0.23
62 0.18
63 0.19
64 0.18
65 0.15
66 0.12
67 0.12
68 0.14
69 0.19
70 0.29
71 0.33
72 0.39
73 0.4
74 0.44
75 0.49
76 0.52
77 0.58
78 0.56
79 0.57
80 0.56
81 0.56
82 0.53
83 0.53
84 0.52
85 0.46
86 0.4
87 0.37
88 0.36
89 0.36
90 0.34
91 0.32
92 0.27
93 0.24
94 0.22
95 0.19
96 0.19
97 0.25
98 0.34
99 0.38
100 0.47
101 0.49
102 0.5
103 0.51
104 0.52
105 0.53
106 0.46
107 0.42
108 0.41
109 0.38
110 0.37
111 0.35
112 0.28
113 0.21
114 0.19
115 0.2
116 0.2
117 0.22
118 0.27
119 0.33
120 0.34