Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R8BMN4

Protein Details
Accession R8BMN4   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-49VSAKKHVPIVKKRTKTFSRHQSDRFKCLSSKWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
32-47KWRKPKGIDNRVRRRF
Subcellular Location(s) mito 18, mito_nucl 14.333, nucl 8.5, cyto_nucl 5.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tmn:UCRPA7_3884  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTKTFSRHQSDRFKCLSSKWRKPKGIDNRVRRRFKGNQVMPSIGFGSNKKTRHMTPSGHKAFLVSNTNDVELLLMHNKTFAAEIAHNVSSRKRIDIIARAKQLGVKVTNPKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.79
4 0.79
5 0.79
6 0.78
7 0.78
8 0.81
9 0.82
10 0.79
11 0.79
12 0.71
13 0.63
14 0.55
15 0.53
16 0.55
17 0.54
18 0.6
19 0.63
20 0.7
21 0.73
22 0.75
23 0.79
24 0.8
25 0.8
26 0.79
27 0.79
28 0.8
29 0.84
30 0.86
31 0.78
32 0.74
33 0.71
34 0.71
35 0.71
36 0.66
37 0.63
38 0.6
39 0.6
40 0.52
41 0.45
42 0.37
43 0.26
44 0.21
45 0.14
46 0.17
47 0.22
48 0.23
49 0.24
50 0.25
51 0.26
52 0.31
53 0.35
54 0.34
55 0.35
56 0.45
57 0.46
58 0.43
59 0.42
60 0.36
61 0.32
62 0.31
63 0.29
64 0.18
65 0.18
66 0.18
67 0.18
68 0.17
69 0.16
70 0.12
71 0.07
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.08
78 0.08
79 0.09
80 0.08
81 0.09
82 0.09
83 0.11
84 0.15
85 0.16
86 0.17
87 0.17
88 0.19
89 0.21
90 0.22
91 0.23
92 0.2
93 0.22
94 0.28
95 0.36
96 0.43
97 0.46
98 0.49
99 0.48
100 0.46
101 0.45
102 0.42
103 0.38
104 0.33
105 0.3
106 0.35
107 0.43
108 0.5
109 0.49
110 0.5
111 0.47