Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4S1I2

Protein Details
Accession F4S1I2    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
30-55TPNSTTSSSKPTKKPKLNPNLKPVATHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.333, mito_nucl 11.999, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002043  UDG_fam1  
IPR018085  Ura-DNA_Glyclase_AS  
IPR005122  Uracil-DNA_glycosylase-like  
IPR036895  Uracil-DNA_glycosylase-like_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005634  C:nucleus  
GO:0004844  F:uracil DNA N-glycosylase activity  
GO:0006284  P:base-excision repair  
KEGG mlr:MELLADRAFT_110942  -  
Pfam View protein in Pfam  
PF03167  UDG  
PROSITE View protein in PROSITE  
PS00130  U_DNA_GLYCOSYLASE  
CDD cd10027  UDG-F1-like  
Amino Acid Sequences MSLPKPGEKRQRSITDMFGGNQPNTKPIPTPNSTTSSSKPTKKPKLNPNLKPVATSSKTSMIRTPYDKLGTIDQETKLTSLSKEHQSLLSLELNPKTGLGPTYLKVLHQELNRTYFLDLKRFLQTEPQSSIFPPSSMIYSWSHRTPLTSIKVVIIGQDPYHGPGQAHGLAFSVPRGIPIPGSLRNIHEELKREYPEDFKKPNHGSLGTWADHGVLLLNTSLTVRKSSAGSHAGRGWEQFTDSVVDAIDLYGGLDLLNQSKPKEDPKDMTQDQTEEGPSSAKKQKVENDECHDLIDQSLNGFGKGVVFLCWGKWAADRVSRLSESKHLILRSAHPSPLSAHRGFLGNGHFKLANEWLANRYGESAMVNWCDLKPDIPINNPLSMTKET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.61
3 0.56
4 0.5
5 0.46
6 0.42
7 0.37
8 0.37
9 0.32
10 0.3
11 0.3
12 0.3
13 0.27
14 0.31
15 0.38
16 0.38
17 0.44
18 0.44
19 0.47
20 0.5
21 0.51
22 0.47
23 0.48
24 0.53
25 0.55
26 0.59
27 0.65
28 0.72
29 0.77
30 0.83
31 0.85
32 0.88
33 0.9
34 0.89
35 0.88
36 0.87
37 0.78
38 0.7
39 0.62
40 0.61
41 0.53
42 0.47
43 0.4
44 0.39
45 0.42
46 0.41
47 0.42
48 0.37
49 0.4
50 0.42
51 0.42
52 0.39
53 0.39
54 0.39
55 0.36
56 0.37
57 0.34
58 0.34
59 0.34
60 0.3
61 0.28
62 0.27
63 0.25
64 0.21
65 0.19
66 0.16
67 0.17
68 0.21
69 0.26
70 0.28
71 0.3
72 0.29
73 0.3
74 0.3
75 0.29
76 0.27
77 0.23
78 0.23
79 0.23
80 0.23
81 0.21
82 0.2
83 0.17
84 0.14
85 0.13
86 0.13
87 0.14
88 0.13
89 0.19
90 0.19
91 0.18
92 0.2
93 0.22
94 0.24
95 0.23
96 0.29
97 0.27
98 0.31
99 0.31
100 0.29
101 0.27
102 0.27
103 0.27
104 0.27
105 0.25
106 0.24
107 0.28
108 0.28
109 0.27
110 0.31
111 0.32
112 0.31
113 0.34
114 0.33
115 0.29
116 0.29
117 0.32
118 0.24
119 0.21
120 0.17
121 0.14
122 0.13
123 0.13
124 0.15
125 0.13
126 0.16
127 0.19
128 0.19
129 0.2
130 0.19
131 0.2
132 0.2
133 0.25
134 0.26
135 0.24
136 0.24
137 0.22
138 0.24
139 0.22
140 0.21
141 0.15
142 0.12
143 0.1
144 0.11
145 0.1
146 0.11
147 0.11
148 0.11
149 0.09
150 0.09
151 0.13
152 0.14
153 0.14
154 0.12
155 0.11
156 0.11
157 0.11
158 0.1
159 0.09
160 0.06
161 0.06
162 0.07
163 0.07
164 0.07
165 0.09
166 0.12
167 0.14
168 0.17
169 0.17
170 0.18
171 0.2
172 0.21
173 0.22
174 0.21
175 0.22
176 0.23
177 0.27
178 0.26
179 0.25
180 0.24
181 0.28
182 0.31
183 0.34
184 0.34
185 0.31
186 0.38
187 0.4
188 0.42
189 0.38
190 0.33
191 0.27
192 0.28
193 0.32
194 0.24
195 0.22
196 0.19
197 0.16
198 0.15
199 0.15
200 0.1
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.06
208 0.06
209 0.07
210 0.07
211 0.08
212 0.09
213 0.1
214 0.15
215 0.2
216 0.21
217 0.22
218 0.23
219 0.23
220 0.23
221 0.23
222 0.19
223 0.13
224 0.13
225 0.11
226 0.09
227 0.1
228 0.09
229 0.09
230 0.08
231 0.08
232 0.07
233 0.06
234 0.06
235 0.03
236 0.03
237 0.03
238 0.03
239 0.03
240 0.03
241 0.04
242 0.06
243 0.08
244 0.09
245 0.1
246 0.12
247 0.15
248 0.22
249 0.28
250 0.31
251 0.33
252 0.37
253 0.47
254 0.46
255 0.47
256 0.41
257 0.36
258 0.33
259 0.29
260 0.25
261 0.16
262 0.15
263 0.14
264 0.13
265 0.18
266 0.24
267 0.26
268 0.27
269 0.32
270 0.4
271 0.48
272 0.56
273 0.57
274 0.58
275 0.6
276 0.57
277 0.53
278 0.46
279 0.35
280 0.28
281 0.22
282 0.14
283 0.09
284 0.12
285 0.11
286 0.1
287 0.1
288 0.1
289 0.08
290 0.09
291 0.09
292 0.07
293 0.09
294 0.1
295 0.1
296 0.12
297 0.12
298 0.13
299 0.15
300 0.18
301 0.2
302 0.26
303 0.28
304 0.29
305 0.34
306 0.35
307 0.34
308 0.34
309 0.35
310 0.35
311 0.36
312 0.37
313 0.32
314 0.34
315 0.35
316 0.38
317 0.4
318 0.38
319 0.35
320 0.31
321 0.32
322 0.32
323 0.38
324 0.39
325 0.32
326 0.3
327 0.29
328 0.31
329 0.3
330 0.3
331 0.29
332 0.29
333 0.29
334 0.31
335 0.3
336 0.28
337 0.31
338 0.3
339 0.27
340 0.22
341 0.24
342 0.23
343 0.26
344 0.26
345 0.23
346 0.22
347 0.18
348 0.17
349 0.16
350 0.15
351 0.16
352 0.17
353 0.18
354 0.17
355 0.17
356 0.19
357 0.19
358 0.18
359 0.19
360 0.25
361 0.29
362 0.32
363 0.4
364 0.39
365 0.42
366 0.42
367 0.39