Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R8BYB0

Protein Details
Accession R8BYB0    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-37MFERMGRREKPRVEREKAKQRAQVKNKNKNKNKGGPSBasic
NLS Segment(s)
PositionSequence
6-34GRREKPRVEREKAKQRAQVKNKNKNKNKG
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
KEGG tmn:UCRPA7_117  -  
Amino Acid Sequences MFERMGRREKPRVEREKAKQRAQVKNKNKNKNKGGPSYLAPEDGDGLLGVVVAEEEEEEEDEVKPAPAERI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.85
4 0.85
5 0.82
6 0.79
7 0.78
8 0.8
9 0.8
10 0.8
11 0.8
12 0.82
13 0.85
14 0.88
15 0.88
16 0.87
17 0.85
18 0.84
19 0.8
20 0.76
21 0.69
22 0.61
23 0.54
24 0.49
25 0.41
26 0.32
27 0.25
28 0.18
29 0.16
30 0.13
31 0.11
32 0.06
33 0.05
34 0.04
35 0.04
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.03
43 0.03
44 0.04
45 0.05
46 0.06
47 0.07
48 0.08
49 0.08
50 0.09
51 0.09