Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4SDT3

Protein Details
Accession F4SDT3    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-34STVRSHHKKHIEDDRRRDRGBasic
NLS Segment(s)
Subcellular Location(s) extr 10, E.R. 5, cyto 3.5, cyto_nucl 3, golg 3, mito 2, nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045055  DNA2/NAM7-like  
IPR041679  DNA2/NAM7-like_C  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0003724  F:RNA helicase activity  
KEGG mlr:MELLADRAFT_70149  -  
Pfam View protein in Pfam  
PF13087  AAA_12  
Amino Acid Sequences MFLLAFSFSRVVIVSTVRSHHKKHIEDDRRRDRGLIFEAQRFNVTLTRPKELLIVVGNAETLTVDPYWRSFYHFTRRMGVYEGAPVLGLGESVADVSVLEERFHRNSYESFEEKLNHGDQLIGLDEDENGIESFDVDGRILVGSVARLALEDSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.19
4 0.26
5 0.31
6 0.33
7 0.41
8 0.48
9 0.5
10 0.56
11 0.64
12 0.66
13 0.72
14 0.79
15 0.81
16 0.78
17 0.74
18 0.67
19 0.57
20 0.52
21 0.47
22 0.44
23 0.37
24 0.37
25 0.38
26 0.37
27 0.37
28 0.31
29 0.27
30 0.22
31 0.21
32 0.23
33 0.24
34 0.27
35 0.26
36 0.26
37 0.26
38 0.23
39 0.22
40 0.16
41 0.14
42 0.1
43 0.1
44 0.09
45 0.08
46 0.08
47 0.05
48 0.04
49 0.05
50 0.04
51 0.04
52 0.05
53 0.06
54 0.09
55 0.09
56 0.13
57 0.15
58 0.19
59 0.29
60 0.35
61 0.36
62 0.37
63 0.38
64 0.35
65 0.35
66 0.32
67 0.22
68 0.17
69 0.16
70 0.11
71 0.1
72 0.09
73 0.06
74 0.05
75 0.04
76 0.03
77 0.02
78 0.02
79 0.03
80 0.03
81 0.02
82 0.02
83 0.03
84 0.05
85 0.06
86 0.06
87 0.08
88 0.11
89 0.13
90 0.14
91 0.15
92 0.15
93 0.16
94 0.22
95 0.27
96 0.26
97 0.26
98 0.28
99 0.28
100 0.27
101 0.3
102 0.25
103 0.18
104 0.16
105 0.15
106 0.12
107 0.13
108 0.12
109 0.09
110 0.08
111 0.08
112 0.07
113 0.07
114 0.07
115 0.07
116 0.05
117 0.05
118 0.05
119 0.06
120 0.07
121 0.07
122 0.08
123 0.07
124 0.07
125 0.07
126 0.07
127 0.07
128 0.06
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06