Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R8BKZ6

Protein Details
Accession R8BKZ6    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
256-283VPWVMKQQGQQRQKKMQKQKQASRNGDEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9.5cyto_nucl 9.5, nucl 8.5, pero 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013216  Methyltransf_11  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
KEGG tmn:UCRPA7_4460  -  
Pfam View protein in Pfam  
PF08241  Methyltransf_11  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MSGDQDVARDHQRQHAEEELEEAAAVAYEETHVHGVYEAIAPHFSATRHKPWPMVSNFLRAQPPGAVGLDVGCGNGKYLAVNPHVVLLGSDRSASLISLARRQFVHDGGAAAAQAAAEGVDVGGGGRPEKGSGTDVMVADGLALPFRDEAVDFVICIAVIHHLSTRERRVDAIRQLLKHVRRKQQQQQGARGAITAGQADDADASVDASKDDVDRRGASRAGSGSGSGQVLVFVWALEQGTSRRGWDEGGEQDLLVPWVMKQQGQQRQKKMQKQKQASRNGDEDKSGEPPPDHQQHPSHTDKTYQRYYHLYRKGELEEDVIAAGGEVLSAGYERDNWWVIAGRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.44
4 0.39
5 0.4
6 0.33
7 0.26
8 0.23
9 0.18
10 0.11
11 0.08
12 0.08
13 0.04
14 0.04
15 0.05
16 0.05
17 0.07
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.09
24 0.11
25 0.1
26 0.1
27 0.11
28 0.11
29 0.11
30 0.13
31 0.12
32 0.18
33 0.23
34 0.3
35 0.36
36 0.39
37 0.42
38 0.45
39 0.54
40 0.49
41 0.52
42 0.46
43 0.49
44 0.48
45 0.49
46 0.46
47 0.37
48 0.35
49 0.27
50 0.26
51 0.19
52 0.18
53 0.14
54 0.11
55 0.11
56 0.1
57 0.09
58 0.08
59 0.07
60 0.06
61 0.06
62 0.07
63 0.07
64 0.06
65 0.09
66 0.14
67 0.15
68 0.17
69 0.16
70 0.17
71 0.17
72 0.16
73 0.14
74 0.11
75 0.1
76 0.09
77 0.09
78 0.08
79 0.09
80 0.09
81 0.08
82 0.08
83 0.11
84 0.12
85 0.18
86 0.19
87 0.21
88 0.21
89 0.24
90 0.24
91 0.21
92 0.22
93 0.16
94 0.16
95 0.14
96 0.14
97 0.12
98 0.09
99 0.08
100 0.05
101 0.04
102 0.03
103 0.03
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.03
111 0.03
112 0.04
113 0.04
114 0.05
115 0.05
116 0.06
117 0.07
118 0.08
119 0.08
120 0.1
121 0.12
122 0.12
123 0.12
124 0.12
125 0.1
126 0.09
127 0.08
128 0.06
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.07
138 0.07
139 0.06
140 0.07
141 0.06
142 0.06
143 0.06
144 0.05
145 0.04
146 0.04
147 0.05
148 0.06
149 0.07
150 0.09
151 0.13
152 0.17
153 0.18
154 0.18
155 0.2
156 0.22
157 0.26
158 0.29
159 0.34
160 0.33
161 0.32
162 0.35
163 0.39
164 0.43
165 0.46
166 0.5
167 0.51
168 0.55
169 0.64
170 0.7
171 0.73
172 0.75
173 0.72
174 0.72
175 0.68
176 0.62
177 0.53
178 0.43
179 0.34
180 0.26
181 0.2
182 0.12
183 0.07
184 0.05
185 0.05
186 0.05
187 0.05
188 0.04
189 0.04
190 0.03
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.04
197 0.05
198 0.07
199 0.09
200 0.11
201 0.12
202 0.14
203 0.17
204 0.17
205 0.17
206 0.18
207 0.17
208 0.16
209 0.14
210 0.13
211 0.11
212 0.12
213 0.11
214 0.09
215 0.08
216 0.06
217 0.06
218 0.07
219 0.06
220 0.04
221 0.04
222 0.05
223 0.05
224 0.05
225 0.06
226 0.06
227 0.08
228 0.09
229 0.1
230 0.1
231 0.11
232 0.11
233 0.12
234 0.15
235 0.15
236 0.17
237 0.17
238 0.15
239 0.15
240 0.15
241 0.14
242 0.1
243 0.07
244 0.05
245 0.09
246 0.1
247 0.11
248 0.15
249 0.24
250 0.34
251 0.44
252 0.52
253 0.57
254 0.67
255 0.75
256 0.81
257 0.83
258 0.83
259 0.84
260 0.86
261 0.87
262 0.86
263 0.88
264 0.85
265 0.79
266 0.78
267 0.73
268 0.63
269 0.55
270 0.48
271 0.39
272 0.35
273 0.31
274 0.26
275 0.21
276 0.23
277 0.3
278 0.35
279 0.35
280 0.37
281 0.41
282 0.45
283 0.52
284 0.55
285 0.5
286 0.44
287 0.51
288 0.52
289 0.55
290 0.58
291 0.52
292 0.5
293 0.54
294 0.6
295 0.62
296 0.64
297 0.59
298 0.53
299 0.56
300 0.56
301 0.49
302 0.43
303 0.35
304 0.28
305 0.24
306 0.21
307 0.16
308 0.12
309 0.09
310 0.08
311 0.05
312 0.03
313 0.03
314 0.03
315 0.03
316 0.03
317 0.04
318 0.05
319 0.06
320 0.08
321 0.12
322 0.14
323 0.14
324 0.16