Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RN63

Protein Details
Accession F4RN63    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-59DQVSSTFVKRKTKKHKSQASNDPTTDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 18, plas 3, mito 2, nucl 1, pero 1, E.R. 1, golg 1, cyto_mito 1
Family & Domain DBs
KEGG mlr:MELLADRAFT_123233  -  
Amino Acid Sequences MKNILSLLFFLQIFLIFGHANTYDRLSARSSASDQVSSTFVKRKTKKHKSQASNDPTTDQPSTGEQPMTCSISRYVRETGLASDCVCAIAFLYDPSFPACTICRTCVVQPLDSKEVPLGGRKDKQGQPMPPSIELARMNSAYDSMFKAQVYTDAPICDPYTTPPGLGDVAMACNASLAAQAYREAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.08
4 0.08
5 0.1
6 0.11
7 0.11
8 0.12
9 0.14
10 0.15
11 0.15
12 0.17
13 0.17
14 0.19
15 0.2
16 0.22
17 0.22
18 0.24
19 0.26
20 0.25
21 0.23
22 0.22
23 0.22
24 0.2
25 0.21
26 0.23
27 0.25
28 0.35
29 0.41
30 0.5
31 0.59
32 0.69
33 0.77
34 0.81
35 0.87
36 0.86
37 0.89
38 0.9
39 0.87
40 0.82
41 0.72
42 0.64
43 0.55
44 0.49
45 0.4
46 0.29
47 0.21
48 0.18
49 0.2
50 0.19
51 0.19
52 0.15
53 0.17
54 0.19
55 0.21
56 0.18
57 0.17
58 0.17
59 0.21
60 0.23
61 0.23
62 0.22
63 0.2
64 0.21
65 0.2
66 0.2
67 0.16
68 0.16
69 0.13
70 0.11
71 0.1
72 0.09
73 0.09
74 0.06
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.04
81 0.05
82 0.06
83 0.06
84 0.06
85 0.07
86 0.08
87 0.11
88 0.12
89 0.13
90 0.14
91 0.16
92 0.16
93 0.23
94 0.24
95 0.24
96 0.24
97 0.28
98 0.31
99 0.29
100 0.29
101 0.21
102 0.21
103 0.18
104 0.21
105 0.19
106 0.2
107 0.24
108 0.26
109 0.34
110 0.36
111 0.44
112 0.46
113 0.48
114 0.48
115 0.51
116 0.52
117 0.45
118 0.43
119 0.35
120 0.33
121 0.28
122 0.25
123 0.22
124 0.19
125 0.19
126 0.17
127 0.17
128 0.12
129 0.13
130 0.13
131 0.12
132 0.14
133 0.13
134 0.13
135 0.13
136 0.16
137 0.17
138 0.16
139 0.16
140 0.15
141 0.16
142 0.18
143 0.18
144 0.16
145 0.14
146 0.16
147 0.19
148 0.19
149 0.18
150 0.17
151 0.18
152 0.17
153 0.17
154 0.14
155 0.09
156 0.1
157 0.1
158 0.1
159 0.08
160 0.07
161 0.07
162 0.07
163 0.07
164 0.07
165 0.08
166 0.09