Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R8BIW8

Protein Details
Accession R8BIW8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTTSVIWKKRQGKKEAKPNVAVKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036219  eEF-1beta-like_sf  
IPR014038  EF1B_bsu/dsu_GNE  
IPR014717  Transl_elong_EF1B/ribosomal_S6  
Gene Ontology GO:0003746  F:translation elongation factor activity  
KEGG tmn:UCRPA7_5227  -  
Pfam View protein in Pfam  
PF00736  EF1_GNE  
Amino Acid Sequences MTTSVIWKKRQGKKEAKPNVAVKSLMIRDVMPRDNETDMNAPEESVGAIKIYDLVWSASEFVAVGFGNKKIRINFVNEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.83
4 0.81
5 0.78
6 0.73
7 0.65
8 0.55
9 0.44
10 0.4
11 0.35
12 0.28
13 0.22
14 0.18
15 0.17
16 0.21
17 0.23
18 0.18
19 0.18
20 0.19
21 0.2
22 0.2
23 0.19
24 0.17
25 0.15
26 0.16
27 0.14
28 0.12
29 0.1
30 0.1
31 0.08
32 0.06
33 0.06
34 0.03
35 0.03
36 0.03
37 0.04
38 0.04
39 0.05
40 0.05
41 0.06
42 0.06
43 0.07
44 0.08
45 0.07
46 0.07
47 0.07
48 0.06
49 0.07
50 0.06
51 0.07
52 0.08
53 0.11
54 0.16
55 0.18
56 0.22
57 0.23
58 0.3
59 0.32