Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R8BY76

Protein Details
Accession R8BY76    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
113-135LAKQKKAEDKIKEKSRLRKLSTLHydrophilic
NLS Segment(s)
PositionSequence
121-128DKIKEKSR
Subcellular Location(s) cysk 10, cyto 8, nucl 3, mito 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR034104  Lsm1  
IPR010920  LSM_dom_sf  
IPR044642  PTHR15588  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0000932  C:P-body  
GO:1990904  C:ribonucleoprotein complex  
GO:0000339  F:RNA cap binding  
GO:0006397  P:mRNA processing  
GO:0000956  P:nuclear-transcribed mRNA catabolic process  
KEGG tmn:UCRPA7_203  -  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01728  LSm1  
Amino Acid Sequences MFTTAAQLLDLTDKKLMVALRDGRKLIGILRSWDQFANLVLQSTVERIFVPPGANPPMGSGESQKRGLYADIPRGMFLVRGENVLLLGEIDLDRDDDPPPGYDKADAELVESLAKQKKAEDKIKEKSRLRKLSTLGFEGENMGEIML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.19
4 0.14
5 0.21
6 0.28
7 0.33
8 0.37
9 0.38
10 0.35
11 0.35
12 0.34
13 0.29
14 0.26
15 0.22
16 0.21
17 0.24
18 0.25
19 0.26
20 0.25
21 0.23
22 0.18
23 0.16
24 0.16
25 0.12
26 0.12
27 0.1
28 0.1
29 0.1
30 0.1
31 0.1
32 0.07
33 0.07
34 0.08
35 0.09
36 0.1
37 0.1
38 0.1
39 0.13
40 0.16
41 0.16
42 0.15
43 0.15
44 0.16
45 0.16
46 0.16
47 0.16
48 0.17
49 0.2
50 0.21
51 0.2
52 0.18
53 0.18
54 0.18
55 0.19
56 0.17
57 0.19
58 0.21
59 0.21
60 0.21
61 0.2
62 0.2
63 0.16
64 0.14
65 0.11
66 0.09
67 0.09
68 0.09
69 0.09
70 0.09
71 0.08
72 0.07
73 0.04
74 0.03
75 0.03
76 0.03
77 0.04
78 0.04
79 0.05
80 0.05
81 0.06
82 0.07
83 0.08
84 0.09
85 0.1
86 0.13
87 0.13
88 0.13
89 0.14
90 0.14
91 0.14
92 0.16
93 0.15
94 0.13
95 0.12
96 0.12
97 0.12
98 0.11
99 0.14
100 0.16
101 0.18
102 0.17
103 0.2
104 0.28
105 0.37
106 0.45
107 0.5
108 0.55
109 0.65
110 0.74
111 0.8
112 0.8
113 0.81
114 0.83
115 0.83
116 0.8
117 0.77
118 0.72
119 0.71
120 0.69
121 0.62
122 0.53
123 0.44
124 0.38
125 0.32
126 0.28
127 0.19