Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R8BKB0

Protein Details
Accession R8BKB0   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
259-278LGFGRRRRSRRVLTAKGEKSBasic
NLS Segment(s)
PositionSequence
263-269RRRRSRR
Subcellular Location(s) mito 16, nucl 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
KEGG tmn:UCRPA7_4634  -  
Amino Acid Sequences MPSQLTKLPTFLNRFPTASIHYRWSETLDEVNAIVTKPDETGEGSGEPPTWLHWPTPIHDTLFGYEWIINNLCPSNTQRRDVYVYGSFIGASLAASLALTESHAHQRMAVRGLLAFNGIYNWTTFLPDHPVNKVKTQSIFDTPHRDAEGTTFHFLKQQIPGLFKSPTNLFDPFASPVLFFHTAGLLVPNSFTDSTVPSSLLRAIDALSGDAHAEEPTVETAFKTPRKGYLAFPPRQSSLKIPESLLLHEMPPPISTAGLGFGRRRRSRRVLTAKGEKSGVNNFQTQAEELAGMMRRSINKLELKERMKWDEDFDDWDHEAERRVRTADVGRVEGVGFELSEHGQELAVSWLEEKMSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.44
4 0.42
5 0.41
6 0.4
7 0.38
8 0.37
9 0.38
10 0.37
11 0.36
12 0.32
13 0.29
14 0.29
15 0.24
16 0.22
17 0.2
18 0.2
19 0.17
20 0.15
21 0.13
22 0.1
23 0.09
24 0.09
25 0.1
26 0.09
27 0.1
28 0.12
29 0.13
30 0.14
31 0.14
32 0.14
33 0.15
34 0.14
35 0.12
36 0.13
37 0.14
38 0.14
39 0.14
40 0.19
41 0.2
42 0.23
43 0.29
44 0.29
45 0.27
46 0.28
47 0.29
48 0.26
49 0.25
50 0.23
51 0.18
52 0.17
53 0.16
54 0.16
55 0.15
56 0.13
57 0.13
58 0.14
59 0.13
60 0.14
61 0.19
62 0.27
63 0.31
64 0.35
65 0.34
66 0.37
67 0.43
68 0.41
69 0.41
70 0.33
71 0.31
72 0.27
73 0.26
74 0.21
75 0.16
76 0.15
77 0.09
78 0.06
79 0.04
80 0.04
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.04
87 0.04
88 0.07
89 0.13
90 0.15
91 0.15
92 0.17
93 0.2
94 0.23
95 0.25
96 0.23
97 0.18
98 0.17
99 0.17
100 0.15
101 0.12
102 0.09
103 0.06
104 0.06
105 0.06
106 0.06
107 0.06
108 0.07
109 0.07
110 0.08
111 0.09
112 0.09
113 0.15
114 0.18
115 0.2
116 0.23
117 0.28
118 0.29
119 0.32
120 0.34
121 0.3
122 0.31
123 0.31
124 0.3
125 0.31
126 0.34
127 0.33
128 0.37
129 0.35
130 0.35
131 0.33
132 0.3
133 0.23
134 0.21
135 0.22
136 0.18
137 0.19
138 0.16
139 0.16
140 0.19
141 0.19
142 0.2
143 0.17
144 0.2
145 0.2
146 0.22
147 0.23
148 0.23
149 0.24
150 0.21
151 0.21
152 0.18
153 0.17
154 0.18
155 0.18
156 0.16
157 0.15
158 0.17
159 0.16
160 0.15
161 0.13
162 0.1
163 0.09
164 0.13
165 0.13
166 0.12
167 0.11
168 0.1
169 0.09
170 0.09
171 0.1
172 0.06
173 0.04
174 0.05
175 0.04
176 0.06
177 0.06
178 0.06
179 0.06
180 0.08
181 0.1
182 0.1
183 0.11
184 0.09
185 0.1
186 0.11
187 0.11
188 0.09
189 0.08
190 0.07
191 0.07
192 0.07
193 0.07
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.04
200 0.04
201 0.04
202 0.04
203 0.05
204 0.06
205 0.06
206 0.05
207 0.08
208 0.14
209 0.17
210 0.2
211 0.2
212 0.24
213 0.29
214 0.31
215 0.31
216 0.36
217 0.43
218 0.43
219 0.46
220 0.45
221 0.43
222 0.42
223 0.42
224 0.35
225 0.34
226 0.35
227 0.33
228 0.3
229 0.31
230 0.31
231 0.3
232 0.27
233 0.2
234 0.15
235 0.16
236 0.16
237 0.13
238 0.12
239 0.12
240 0.1
241 0.1
242 0.09
243 0.07
244 0.09
245 0.11
246 0.13
247 0.16
248 0.2
249 0.3
250 0.37
251 0.41
252 0.47
253 0.55
254 0.61
255 0.68
256 0.74
257 0.73
258 0.76
259 0.82
260 0.76
261 0.7
262 0.63
263 0.53
264 0.46
265 0.43
266 0.4
267 0.32
268 0.32
269 0.3
270 0.3
271 0.3
272 0.27
273 0.22
274 0.16
275 0.13
276 0.11
277 0.13
278 0.14
279 0.12
280 0.12
281 0.14
282 0.15
283 0.18
284 0.21
285 0.25
286 0.29
287 0.34
288 0.4
289 0.47
290 0.49
291 0.54
292 0.57
293 0.56
294 0.54
295 0.5
296 0.48
297 0.43
298 0.41
299 0.38
300 0.34
301 0.33
302 0.3
303 0.29
304 0.25
305 0.21
306 0.26
307 0.26
308 0.26
309 0.25
310 0.26
311 0.26
312 0.29
313 0.34
314 0.35
315 0.34
316 0.33
317 0.31
318 0.3
319 0.29
320 0.25
321 0.21
322 0.14
323 0.1
324 0.07
325 0.09
326 0.08
327 0.09
328 0.09
329 0.08
330 0.08
331 0.08
332 0.09
333 0.1
334 0.1
335 0.1
336 0.1
337 0.11