Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PSU1

Protein Details
Accession A0A1D8PSU1    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-31QGNLKLKSKQSNRITKKQQNPKKAAPKIIHydrophilic
NLS Segment(s)
PositionSequence
10-39SKQSNRITKKQQNPKKAAPKIIKPKKTIAK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG cal:CAALFM_CR04750WA  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGNLKLKSKQSNRITKKQQNPKKAAPKIIKPKKTIAKESLKLTKIHSGQLMKSTEKLIASRVGHLELIKGSRRQVEKENKQQANKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.78
3 0.84
4 0.83
5 0.87
6 0.87
7 0.87
8 0.86
9 0.85
10 0.85
11 0.85
12 0.81
13 0.8
14 0.76
15 0.77
16 0.77
17 0.8
18 0.76
19 0.69
20 0.72
21 0.71
22 0.7
23 0.66
24 0.63
25 0.62
26 0.59
27 0.61
28 0.6
29 0.53
30 0.48
31 0.43
32 0.42
33 0.34
34 0.31
35 0.3
36 0.24
37 0.23
38 0.28
39 0.29
40 0.23
41 0.23
42 0.22
43 0.2
44 0.19
45 0.18
46 0.14
47 0.18
48 0.18
49 0.2
50 0.2
51 0.2
52 0.2
53 0.19
54 0.19
55 0.14
56 0.17
57 0.19
58 0.2
59 0.21
60 0.27
61 0.3
62 0.33
63 0.41
64 0.49
65 0.55
66 0.64
67 0.72
68 0.73