Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R8BFY6

Protein Details
Accession R8BFY6    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-34DYSSNPSTIRARRRKDKLQGGAKVLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 7, pero 2
Family & Domain DBs
KEGG tmn:UCRPA7_6268  -  
Amino Acid Sequences MTPQLKGPEDYSSNPSTIRARRRKDKLQGGAKVLDHAKMADYKALIDARKAVQKKDEYKKATKPMQEQMLTEAMASTMEKRFMANNGPMPPAPHQAYPVSSSPSLFVNHPMTTMSAPFHTIPNPPPPAAHFPRTSTATADGNMPGGGDVDSIRSILENLVPAVRNVTRHVDNLHTQVGQLRQELCAHTNRAGETDTKVVQAENDVQVLTSETVPQLWEALSKLETAVSGIETKVGQGSDAEMTKMRGVMRGFQDALNSAGGYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.34
4 0.38
5 0.45
6 0.49
7 0.56
8 0.66
9 0.75
10 0.82
11 0.85
12 0.87
13 0.86
14 0.86
15 0.84
16 0.78
17 0.74
18 0.64
19 0.59
20 0.5
21 0.41
22 0.31
23 0.24
24 0.21
25 0.19
26 0.19
27 0.17
28 0.16
29 0.15
30 0.19
31 0.22
32 0.2
33 0.18
34 0.21
35 0.22
36 0.3
37 0.31
38 0.29
39 0.34
40 0.41
41 0.5
42 0.57
43 0.63
44 0.62
45 0.68
46 0.74
47 0.75
48 0.74
49 0.71
50 0.67
51 0.65
52 0.67
53 0.61
54 0.53
55 0.47
56 0.42
57 0.35
58 0.28
59 0.2
60 0.12
61 0.1
62 0.1
63 0.09
64 0.08
65 0.09
66 0.09
67 0.1
68 0.11
69 0.13
70 0.17
71 0.19
72 0.23
73 0.24
74 0.26
75 0.26
76 0.27
77 0.27
78 0.28
79 0.26
80 0.22
81 0.21
82 0.21
83 0.22
84 0.23
85 0.22
86 0.2
87 0.18
88 0.18
89 0.16
90 0.17
91 0.16
92 0.13
93 0.16
94 0.16
95 0.16
96 0.16
97 0.15
98 0.15
99 0.14
100 0.14
101 0.11
102 0.08
103 0.09
104 0.1
105 0.1
106 0.11
107 0.12
108 0.14
109 0.2
110 0.22
111 0.2
112 0.2
113 0.22
114 0.28
115 0.3
116 0.32
117 0.26
118 0.26
119 0.29
120 0.32
121 0.29
122 0.23
123 0.21
124 0.18
125 0.17
126 0.16
127 0.13
128 0.11
129 0.1
130 0.08
131 0.06
132 0.05
133 0.05
134 0.04
135 0.04
136 0.05
137 0.05
138 0.05
139 0.05
140 0.04
141 0.05
142 0.05
143 0.06
144 0.05
145 0.06
146 0.07
147 0.08
148 0.08
149 0.1
150 0.11
151 0.11
152 0.13
153 0.17
154 0.18
155 0.19
156 0.21
157 0.22
158 0.23
159 0.25
160 0.25
161 0.2
162 0.18
163 0.2
164 0.22
165 0.19
166 0.19
167 0.17
168 0.16
169 0.18
170 0.19
171 0.18
172 0.2
173 0.2
174 0.21
175 0.22
176 0.21
177 0.21
178 0.21
179 0.2
180 0.18
181 0.19
182 0.17
183 0.16
184 0.16
185 0.15
186 0.14
187 0.15
188 0.16
189 0.14
190 0.14
191 0.12
192 0.12
193 0.12
194 0.14
195 0.12
196 0.09
197 0.09
198 0.08
199 0.09
200 0.09
201 0.09
202 0.08
203 0.07
204 0.08
205 0.08
206 0.1
207 0.1
208 0.1
209 0.1
210 0.1
211 0.09
212 0.09
213 0.09
214 0.08
215 0.08
216 0.08
217 0.1
218 0.09
219 0.1
220 0.11
221 0.1
222 0.09
223 0.09
224 0.11
225 0.13
226 0.14
227 0.15
228 0.15
229 0.16
230 0.17
231 0.19
232 0.18
233 0.19
234 0.2
235 0.26
236 0.29
237 0.33
238 0.34
239 0.32
240 0.33
241 0.3
242 0.3
243 0.24