Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R8BJ26

Protein Details
Accession R8BJ26    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
48-79YIHFATLKPEQKKKKKDDKKAPAKGGKPPAQRBasic
NLS Segment(s)
PositionSequence
57-79EQKKKKKDDKKAPAKGGKPPAQR
Subcellular Location(s) cyto 10, extr 7, cyto_nucl 7, plas 3, nucl 2, E.R. 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG tmn:UCRPA7_5113  -  
Amino Acid Sequences MAPGQFDWFLKIGATKEAVAVLNDQPFLFTILLLVLVGIILQCVLIWYIHFATLKPEQKKKKKDDKKAPAKGGKPPAQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.13
4 0.15
5 0.15
6 0.13
7 0.14
8 0.14
9 0.14
10 0.14
11 0.13
12 0.12
13 0.11
14 0.13
15 0.11
16 0.08
17 0.07
18 0.06
19 0.06
20 0.06
21 0.05
22 0.03
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.03
33 0.03
34 0.05
35 0.05
36 0.08
37 0.08
38 0.08
39 0.12
40 0.2
41 0.28
42 0.33
43 0.42
44 0.51
45 0.61
46 0.71
47 0.77
48 0.8
49 0.83
50 0.88
51 0.91
52 0.92
53 0.93
54 0.93
55 0.93
56 0.91
57 0.85
58 0.83
59 0.82