Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R8BMM0

Protein Details
Accession R8BMM0   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-33EFKEIRKEWKARKKEEEAQRKABasic
NLS Segment(s)
PositionSequence
15-31EIRKEWKARKKEEEAQR
Subcellular Location(s) nucl 12.5, cyto_nucl 11, cyto 8.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
KEGG tmn:UCRPA7_3862  -  
Amino Acid Sequences MQSHGQKRTPEEFKEIRKEWKARKKEEEAQRKAEEERQRQAAAAAAQNGGPDGQPGPDQPPTSYPGSRPVQLPPIAYQQQTQYPAPPGSGQPLPEYGANYMHPNYQPASPYGQPNQQMYSQRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.63
3 0.63
4 0.65
5 0.7
6 0.71
7 0.74
8 0.76
9 0.75
10 0.8
11 0.79
12 0.8
13 0.82
14 0.83
15 0.79
16 0.77
17 0.71
18 0.64
19 0.57
20 0.55
21 0.54
22 0.49
23 0.48
24 0.45
25 0.43
26 0.4
27 0.38
28 0.33
29 0.26
30 0.21
31 0.17
32 0.13
33 0.13
34 0.12
35 0.12
36 0.09
37 0.07
38 0.06
39 0.05
40 0.05
41 0.05
42 0.06
43 0.09
44 0.12
45 0.13
46 0.13
47 0.14
48 0.17
49 0.19
50 0.19
51 0.17
52 0.22
53 0.24
54 0.25
55 0.24
56 0.23
57 0.26
58 0.26
59 0.27
60 0.21
61 0.26
62 0.27
63 0.26
64 0.25
65 0.22
66 0.25
67 0.28
68 0.26
69 0.21
70 0.23
71 0.23
72 0.22
73 0.21
74 0.18
75 0.19
76 0.2
77 0.19
78 0.16
79 0.17
80 0.18
81 0.18
82 0.19
83 0.15
84 0.16
85 0.16
86 0.18
87 0.17
88 0.2
89 0.19
90 0.2
91 0.21
92 0.21
93 0.21
94 0.2
95 0.26
96 0.25
97 0.3
98 0.33
99 0.38
100 0.4
101 0.41
102 0.43
103 0.42