Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S1Q7

Protein Details
Accession F4S1Q7    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-29GKGKSIYCPLGQKKKKRRVESPRGSAIVHydrophilic
NLS Segment(s)
PositionSequence
14-20KKKKRRV
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_111003  -  
Amino Acid Sequences MGKGKSIYCPLGQKKKKRRVESPRGSAIVVARVETSQAQYVKNRLEELEVALQQAGAGSNNPTGQGRDDAIADLSHGNNRGSDELPQIHTDEDDDNDNHDYETHADAAVVPNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.81
3 0.87
4 0.86
5 0.88
6 0.88
7 0.9
8 0.9
9 0.88
10 0.85
11 0.76
12 0.67
13 0.58
14 0.47
15 0.41
16 0.31
17 0.22
18 0.15
19 0.13
20 0.14
21 0.13
22 0.14
23 0.13
24 0.14
25 0.15
26 0.17
27 0.21
28 0.23
29 0.23
30 0.22
31 0.18
32 0.18
33 0.17
34 0.17
35 0.17
36 0.14
37 0.13
38 0.12
39 0.11
40 0.09
41 0.09
42 0.07
43 0.03
44 0.04
45 0.04
46 0.05
47 0.05
48 0.06
49 0.07
50 0.07
51 0.08
52 0.09
53 0.09
54 0.09
55 0.1
56 0.09
57 0.1
58 0.09
59 0.08
60 0.08
61 0.08
62 0.09
63 0.1
64 0.1
65 0.1
66 0.12
67 0.13
68 0.13
69 0.14
70 0.17
71 0.18
72 0.2
73 0.2
74 0.2
75 0.18
76 0.17
77 0.17
78 0.14
79 0.13
80 0.15
81 0.14
82 0.16
83 0.17
84 0.17
85 0.16
86 0.14
87 0.15
88 0.13
89 0.15
90 0.14
91 0.12
92 0.12
93 0.12