Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R8BGC1

Protein Details
Accession R8BGC1   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
74-98IQQSKSQAEKEKKKRAKARILIEHLHydrophilic
NLS Segment(s)
PositionSequence
83-92KEKKKRAKAR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025845  Thg1_C_dom  
IPR007537  tRNAHis_GuaTrfase_Thg1  
IPR038469  tRNAHis_GuaTrfase_Thg1_sf  
Gene Ontology GO:0000287  F:magnesium ion binding  
GO:0008193  F:tRNA guanylyltransferase activity  
GO:0006400  P:tRNA modification  
KEGG tmn:UCRPA7_6154  -  
Pfam View protein in Pfam  
PF14413  Thg1C  
Amino Acid Sequences MESVTSTDMYSVRETIKGTLSSDKNEILFSRFKINYNNEAEIYKKGSTIFRDYELVEPGSHQAAEDAENIAEPIQQSKSQAEKEKKKRAKARILIEHLDIIKDEFWDRRPWLLSNKPGKIPKET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.22
4 0.21
5 0.22
6 0.28
7 0.29
8 0.3
9 0.31
10 0.3
11 0.27
12 0.26
13 0.25
14 0.2
15 0.21
16 0.2
17 0.25
18 0.25
19 0.26
20 0.32
21 0.36
22 0.4
23 0.42
24 0.42
25 0.35
26 0.34
27 0.34
28 0.29
29 0.28
30 0.2
31 0.16
32 0.15
33 0.17
34 0.19
35 0.23
36 0.22
37 0.21
38 0.22
39 0.22
40 0.22
41 0.21
42 0.19
43 0.14
44 0.13
45 0.12
46 0.11
47 0.09
48 0.07
49 0.06
50 0.05
51 0.07
52 0.07
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.05
60 0.06
61 0.07
62 0.08
63 0.1
64 0.12
65 0.17
66 0.21
67 0.3
68 0.38
69 0.47
70 0.57
71 0.67
72 0.71
73 0.77
74 0.81
75 0.82
76 0.83
77 0.81
78 0.81
79 0.8
80 0.79
81 0.72
82 0.64
83 0.58
84 0.47
85 0.39
86 0.29
87 0.2
88 0.14
89 0.13
90 0.13
91 0.13
92 0.15
93 0.21
94 0.23
95 0.26
96 0.29
97 0.32
98 0.39
99 0.45
100 0.53
101 0.56
102 0.6
103 0.64
104 0.68