Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R8BQT0

Protein Details
Accession R8BQT0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-27ASAKAKKRKAQDDGGARKKRKBasic
NLS Segment(s)
PositionSequence
9-29AKAKKRKAQDDGGARKKRKSK
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032704  Cms1  
KEGG tmn:UCRPA7_2835  -  
Pfam View protein in Pfam  
PF14617  CMS1  
Amino Acid Sequences MATTAPASAKAKKRKAQDDGGARKKRKSKYEEDESLLDLKAGVNTVFTFMDSQLLSDYVTKKTTKFGTDLSPVELSDLYISANAVKDTTSWQKLRTLSNLPDFLESFVKDPKELGEAPTKKGAPHTIIVTGAGIRAADIVRKYQKKGNSVAKLFAKHIKLDEAVDFLNRSRTGLGVGTPARLMDLLDNGALSVEHLKRIVVDASHIDQKKRGVMDMKDTMMPLAKWLARKEFKDRYTDEQKPLDLLFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.76
3 0.78
4 0.78
5 0.78
6 0.8
7 0.84
8 0.84
9 0.77
10 0.77
11 0.76
12 0.75
13 0.74
14 0.72
15 0.72
16 0.72
17 0.79
18 0.78
19 0.75
20 0.68
21 0.6
22 0.54
23 0.43
24 0.33
25 0.22
26 0.16
27 0.12
28 0.1
29 0.08
30 0.07
31 0.07
32 0.09
33 0.09
34 0.09
35 0.1
36 0.09
37 0.12
38 0.11
39 0.11
40 0.1
41 0.1
42 0.1
43 0.12
44 0.14
45 0.14
46 0.17
47 0.18
48 0.18
49 0.23
50 0.26
51 0.25
52 0.26
53 0.26
54 0.28
55 0.33
56 0.33
57 0.31
58 0.28
59 0.25
60 0.24
61 0.21
62 0.15
63 0.1
64 0.09
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.1
75 0.16
76 0.21
77 0.21
78 0.23
79 0.28
80 0.31
81 0.33
82 0.34
83 0.33
84 0.32
85 0.36
86 0.37
87 0.32
88 0.31
89 0.28
90 0.25
91 0.21
92 0.17
93 0.13
94 0.14
95 0.14
96 0.12
97 0.12
98 0.11
99 0.13
100 0.13
101 0.14
102 0.21
103 0.22
104 0.24
105 0.28
106 0.27
107 0.24
108 0.26
109 0.25
110 0.18
111 0.18
112 0.17
113 0.14
114 0.14
115 0.14
116 0.12
117 0.1
118 0.07
119 0.06
120 0.04
121 0.03
122 0.04
123 0.04
124 0.05
125 0.06
126 0.1
127 0.17
128 0.2
129 0.22
130 0.26
131 0.31
132 0.34
133 0.42
134 0.48
135 0.48
136 0.47
137 0.51
138 0.5
139 0.47
140 0.45
141 0.43
142 0.35
143 0.28
144 0.27
145 0.24
146 0.21
147 0.2
148 0.19
149 0.15
150 0.13
151 0.13
152 0.12
153 0.1
154 0.14
155 0.13
156 0.13
157 0.12
158 0.12
159 0.12
160 0.12
161 0.13
162 0.13
163 0.14
164 0.14
165 0.13
166 0.13
167 0.12
168 0.11
169 0.11
170 0.06
171 0.07
172 0.07
173 0.07
174 0.07
175 0.07
176 0.07
177 0.06
178 0.06
179 0.1
180 0.1
181 0.11
182 0.12
183 0.12
184 0.12
185 0.14
186 0.16
187 0.1
188 0.12
189 0.14
190 0.18
191 0.26
192 0.28
193 0.27
194 0.28
195 0.31
196 0.33
197 0.31
198 0.32
199 0.31
200 0.32
201 0.39
202 0.42
203 0.41
204 0.38
205 0.36
206 0.33
207 0.29
208 0.26
209 0.19
210 0.19
211 0.2
212 0.23
213 0.27
214 0.36
215 0.4
216 0.45
217 0.53
218 0.57
219 0.58
220 0.62
221 0.63
222 0.62
223 0.65
224 0.68
225 0.66
226 0.61
227 0.58
228 0.53