Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R8BLF2

Protein Details
Accession R8BLF2   
Localization Confidence High
Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
274-303LDENRPPPPDKNKKVKTPRKKSKAADNGEDBasic
344-366GMEDWLRPKKREKKTTINEGTKMHydrophilic
NLS Segment(s)
PositionSequence
279-296PPPPDKNKKVKTPRKKSK
353-354KR
Subcellular Location(s) nucl 13, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004601  UvdE  
Gene Ontology GO:0004519  F:endonuclease activity  
GO:0006289  P:nucleotide-excision repair  
GO:0009411  P:response to UV  
KEGG tmn:UCRPA7_4329  -  
Pfam View protein in Pfam  
PF03851  UvdE  
Amino Acid Sequences MLRWNEKYGIKFMRLSSEMFPFASHPEHGYSLTPFAKEVLADAGKVATELGHRLTTHPGQFTQLGSPRKEVITAAVRDLEYHDEMLSLLKLSPQQNRDAVMILHMGGTYGDKMATLDRFRTNYSSLLSDSIKLRLVLENDDVAWSVHDLLPICEELNIPLVLDYHHHNIIFDADKCREGTYDISQPEIMERISATWKRKGITQKMHYSEPCAGATTPRDRRKHSARVMTLPPCPPDSDLMIEAKDKEQAVFELMKNFKLPGYDRINDVVPYERLDENRPPPPDKNKKVKTPRKKSKAADNGEDQNGASGDGVDLIESSARKQLEISAEDFAMGGPSSRVYWPVGMEDWLRPKKREKKTTINEGTKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.38
4 0.36
5 0.34
6 0.3
7 0.29
8 0.22
9 0.24
10 0.24
11 0.21
12 0.19
13 0.2
14 0.21
15 0.22
16 0.23
17 0.21
18 0.25
19 0.25
20 0.24
21 0.21
22 0.2
23 0.2
24 0.17
25 0.16
26 0.17
27 0.15
28 0.15
29 0.15
30 0.14
31 0.13
32 0.13
33 0.12
34 0.06
35 0.07
36 0.09
37 0.11
38 0.13
39 0.14
40 0.16
41 0.22
42 0.27
43 0.29
44 0.3
45 0.28
46 0.29
47 0.3
48 0.3
49 0.3
50 0.32
51 0.34
52 0.34
53 0.35
54 0.34
55 0.33
56 0.33
57 0.26
58 0.25
59 0.27
60 0.26
61 0.26
62 0.26
63 0.25
64 0.25
65 0.26
66 0.24
67 0.17
68 0.16
69 0.15
70 0.12
71 0.12
72 0.13
73 0.11
74 0.08
75 0.07
76 0.08
77 0.13
78 0.17
79 0.23
80 0.25
81 0.29
82 0.3
83 0.32
84 0.31
85 0.28
86 0.24
87 0.19
88 0.17
89 0.12
90 0.11
91 0.08
92 0.08
93 0.06
94 0.07
95 0.06
96 0.05
97 0.05
98 0.05
99 0.05
100 0.07
101 0.11
102 0.12
103 0.15
104 0.18
105 0.2
106 0.22
107 0.24
108 0.24
109 0.22
110 0.22
111 0.21
112 0.18
113 0.19
114 0.18
115 0.18
116 0.17
117 0.17
118 0.16
119 0.15
120 0.15
121 0.15
122 0.15
123 0.15
124 0.15
125 0.14
126 0.13
127 0.13
128 0.12
129 0.09
130 0.08
131 0.06
132 0.06
133 0.07
134 0.08
135 0.08
136 0.08
137 0.09
138 0.09
139 0.09
140 0.08
141 0.07
142 0.06
143 0.08
144 0.08
145 0.07
146 0.06
147 0.06
148 0.06
149 0.07
150 0.09
151 0.1
152 0.12
153 0.12
154 0.11
155 0.11
156 0.13
157 0.15
158 0.13
159 0.14
160 0.14
161 0.15
162 0.15
163 0.15
164 0.13
165 0.12
166 0.14
167 0.14
168 0.19
169 0.18
170 0.18
171 0.18
172 0.18
173 0.16
174 0.15
175 0.11
176 0.06
177 0.06
178 0.06
179 0.11
180 0.15
181 0.18
182 0.22
183 0.24
184 0.24
185 0.3
186 0.37
187 0.41
188 0.47
189 0.51
190 0.55
191 0.57
192 0.61
193 0.56
194 0.51
195 0.45
196 0.37
197 0.3
198 0.22
199 0.19
200 0.16
201 0.2
202 0.25
203 0.31
204 0.37
205 0.41
206 0.44
207 0.52
208 0.59
209 0.65
210 0.64
211 0.64
212 0.6
213 0.63
214 0.65
215 0.61
216 0.56
217 0.49
218 0.43
219 0.34
220 0.31
221 0.26
222 0.22
223 0.19
224 0.17
225 0.16
226 0.16
227 0.15
228 0.15
229 0.15
230 0.14
231 0.15
232 0.13
233 0.11
234 0.11
235 0.11
236 0.13
237 0.15
238 0.15
239 0.2
240 0.21
241 0.21
242 0.21
243 0.21
244 0.19
245 0.19
246 0.21
247 0.21
248 0.28
249 0.28
250 0.3
251 0.32
252 0.32
253 0.29
254 0.28
255 0.24
256 0.17
257 0.18
258 0.19
259 0.19
260 0.19
261 0.24
262 0.29
263 0.31
264 0.37
265 0.4
266 0.41
267 0.46
268 0.55
269 0.62
270 0.64
271 0.7
272 0.71
273 0.78
274 0.85
275 0.89
276 0.9
277 0.9
278 0.92
279 0.9
280 0.92
281 0.87
282 0.87
283 0.86
284 0.82
285 0.78
286 0.73
287 0.7
288 0.62
289 0.57
290 0.45
291 0.36
292 0.29
293 0.22
294 0.15
295 0.09
296 0.07
297 0.07
298 0.07
299 0.05
300 0.05
301 0.05
302 0.07
303 0.07
304 0.09
305 0.13
306 0.13
307 0.13
308 0.14
309 0.18
310 0.23
311 0.25
312 0.26
313 0.24
314 0.23
315 0.23
316 0.23
317 0.18
318 0.13
319 0.1
320 0.08
321 0.06
322 0.07
323 0.09
324 0.1
325 0.12
326 0.13
327 0.15
328 0.15
329 0.18
330 0.19
331 0.2
332 0.21
333 0.25
334 0.34
335 0.41
336 0.44
337 0.45
338 0.54
339 0.62
340 0.7
341 0.76
342 0.75
343 0.77
344 0.83
345 0.9
346 0.91