Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R8BUD2

Protein Details
Accession R8BUD2   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
83-109YVPSGRPRGRPPKPKATGKPGRPRKSDBasic
NLS Segment(s)
PositionSequence
36-108PVKRRGRPPKEDGAKVTKPKPKPKATGGTGRPRGRPPLDPSQRKTKPYVPSGRPRGRPPKPKATGKPGRPRKS
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
KEGG tmn:UCRPA7_1513  -  
Amino Acid Sequences MAPTKPAARRGRLSKAEAGAETQEDKATSAANGAEPVKRRGRPPKEDGAKVTKPKPKPKATGGTGRPRGRPPLDPSQRKTKPYVPSGRPRGRPPKPKATGKPGRPRKSDAAAIKEALPESDDKVEEEVEGEDEEEYAEAEGEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.61
3 0.57
4 0.48
5 0.43
6 0.34
7 0.29
8 0.25
9 0.2
10 0.17
11 0.14
12 0.14
13 0.12
14 0.11
15 0.09
16 0.09
17 0.09
18 0.08
19 0.1
20 0.11
21 0.14
22 0.16
23 0.22
24 0.28
25 0.3
26 0.36
27 0.45
28 0.53
29 0.58
30 0.62
31 0.67
32 0.67
33 0.69
34 0.66
35 0.64
36 0.62
37 0.59
38 0.6
39 0.56
40 0.56
41 0.62
42 0.67
43 0.66
44 0.65
45 0.67
46 0.68
47 0.65
48 0.67
49 0.64
50 0.65
51 0.66
52 0.63
53 0.58
54 0.51
55 0.52
56 0.45
57 0.43
58 0.39
59 0.42
60 0.48
61 0.52
62 0.53
63 0.59
64 0.61
65 0.59
66 0.57
67 0.54
68 0.51
69 0.53
70 0.59
71 0.55
72 0.6
73 0.68
74 0.72
75 0.69
76 0.71
77 0.73
78 0.73
79 0.76
80 0.74
81 0.75
82 0.75
83 0.8
84 0.79
85 0.79
86 0.79
87 0.79
88 0.82
89 0.82
90 0.82
91 0.77
92 0.76
93 0.72
94 0.68
95 0.66
96 0.62
97 0.58
98 0.52
99 0.49
100 0.43
101 0.39
102 0.33
103 0.25
104 0.19
105 0.13
106 0.14
107 0.15
108 0.15
109 0.14
110 0.15
111 0.15
112 0.14
113 0.14
114 0.12
115 0.1
116 0.1
117 0.09
118 0.08
119 0.08
120 0.08
121 0.07
122 0.06
123 0.05